Active Recombinant SARS-CoV1 3CL Protease, His-tagged
| Cat.No. : | nsp5-107S |
| Product Overview : | Recombinant 3-chymotrypsin-like (3CL) protease of the SARS-CoV1, a monomeric polypeptide of 318 (307+11) amino acids, with His at C-terminus was expressed in E coli cells and purified by an affinity column in combination of other chromatograph methods. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | SARS-CoV-1 |
| Source : | E.coli |
| Tag : | His |
| Description : | Severe Acute Respiratory Syndrome (SARS), an emerging disease characterized by atypical pneumonia, has been attributed to a novel coronavirus (SARS CoV). The SARS 3C like protease (SARS 3CL(pro)) is a cysteine protease engaging in the proteolytic cleavage of the viral precursor polyprotein to a series of functional proteins required for coronavirus replication and is considered as an attractive target for therapeutics against SARS. |
| Bio-activity : | Recombinant 3CL protease of SARS-CoV1 is suitable for screening its inhibitors and other related function assays. |
| Molecular Mass : | 34 kDa |
| AA Sequence : | MSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVTFQGGGLEHHHHHH* |
| Purity : | ≥ 90%, as determined by SDS-PAGE. |
| Storage : | The protein sample can be stored under sterile conditions at 2-8 centigrade for one month or at -20 to -70 centigrade for three months without detectable loss of activity. |
| Storage Buffer : | Formulation 20 mM Tris-Cl, pH7.9, 20% glycerol, 100 mM NaCl, 1 mM DTT and 0.5 mM EDTA. |
| ◆ Recombinant Proteins | ||
| nsp5-107S | Active Recombinant SARS-CoV1 3CL Protease, His-tagged | +Inquiry |
| nsp5-106S | Active Recombinant SARS-CoV2 3CL Protease, His-tagged | +Inquiry |
| nsp5-108M | Active Recombinant MERS 3CL Protease, His-tagged | +Inquiry |
| NSP5-5744S | Recombinant SARS-CoV-2 NSP5/3CL-PRO/M Pro Protein (Ser3264-Thr3567), N-GST tagged | +Inquiry |
| NSP5-1490B | Recombinant Bat coronavirus HKU4 NSP5 Protein (S3292-Q3597) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All nsp5 Products
Required fields are marked with *
My Review for All nsp5 Products
Required fields are marked with *
