"BMI1" Related Products

Expand
Expand

Recombinant Human BMI1, GST-tagged

Cat. No. : BMI1-27487H
ProductOverview : Recombinant Human BMI1 protein, fused with a GST tag, was expressed in E. coil.
Description : BMI1 polycomb ring finger oncogene, also known as BMI1, is a protein which in humans is encoded by the BMI1 gene.
Source : E. coil
Species : Human
Purity : 95.0%
Sequenceof amino acids : MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLF KNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAA MTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE
Formulation : Liquid in 6M guanidine hydrochloride,20mM Tris
Applications : SDS-PAGE, ELISA, Western blot
Storage : Store at 2-8°C for immediate use or -20°C for long term storage, avoid repeat freeze thaws.
Gene Name : BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ]
Synonyms : BMI1; BMI1 polycomb ring finger oncogene; PCGF4; RNF51; FLVI2/BMI1; MGC12685; polycomb complex protein BMI-1; polycomb complex protein BMI-1; flvi-2/bmi-1; ring finger protein 51; polycomb group protein Bmi1; polycomb group RING finger protein 4; B lymphoma Mo-MLV insertion region 1 homolog; murine leukemia viral (bmi-1) oncogene homolog
Gene ID : 648
mRNA Refseq : NM_005180
Protein Refseq : NP_005171
MIM : 164831
UniProt ID : P35226
Chromosome Location : 10p11.23
Pathway : Senescence and Autophagy; Transcriptional misregulation in cancer; Validated targets of C-MYC transcriptional activation
Function : RING-like zinc finger domain binding; chromatin binding; protein binding; sequence-specific DNA binding; ubiquitin-protein ligase activity; zinc ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.