Recombinant Human BMI1, GST-tagged
Cat.No. : | BMI1-27487H |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
ProductOverview : | Recombinant Human BMI1 protein, fused with a GST tag, was expressed in E. coil. |
Description : | BMI1 polycomb ring finger oncogene, also known as BMI1, is a protein which in humans is encoded by the BMI1 gene. |
Purity : | 95.0% |
Sequenceof amino acids : | MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLF KNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAA MTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE |
Formulation : | Liquid in 6M guanidine hydrochloride,20mM Tris |
Applications : | SDS-PAGE, ELISA, Western blot |
Storage : | Store at 2-8°C for immediate use or -20°C for long term storage, avoid repeat freeze thaws. |
Gene Name | BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ] |
Synonyms | BMI1; BMI1 polycomb ring finger oncogene; PCGF4; RNF51; FLVI2/BMI1; MGC12685; polycomb complex protein BMI-1; polycomb complex protein BMI-1; flvi-2/bmi-1; ring finger protein 51; polycomb group protein Bmi1; polycomb group RING finger protein 4; B lymphoma Mo-MLV insertion region 1 homolog; murine leukemia viral (bmi-1) oncogene homolog |
Gene ID | 648 |
mRNA Refseq | NM_005180 |
Protein Refseq | NP_005171 |
MIM | 164831 |
UniProt ID | P35226 |
Chromosome Location | 10p11.23 |
Pathway | Senescence and Autophagy; Transcriptional misregulation in cancer; Validated targets of C-MYC transcriptional activation |
Function | RING-like zinc finger domain binding; chromatin binding; protein binding; sequence-specific DNA binding; ubiquitin-protein ligase activity; zinc ion binding |
◆ Recombinant Proteins | ||
BMI1-10246H | Recombinant Human BMI1, GST-tagged | +Inquiry |
BMI1-37HF | Recombinant Full Length Human BMI1 Protein | +Inquiry |
BMI1-1049M | Recombinant Mouse BMI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BMI1-1821C | Recombinant Chicken BMI1 | +Inquiry |
BMI1-350H | Recombinant Human BMI1 protein, His/MBP-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMI1-8437HCL | Recombinant Human BMI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BMI1 Products
Required fields are marked with *
My Review for All BMI1 Products
Required fields are marked with *