Recombinant Human BMI1, GST-tagged

Cat.No. : BMI1-27487H
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
ProductOverview : Recombinant Human BMI1 protein, fused with a GST tag, was expressed in E. coil.
Description : BMI1 polycomb ring finger oncogene, also known as BMI1, is a protein which in humans is encoded by the BMI1 gene.
Purity : 95.0%
Sequenceof amino acids : MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLF KNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAA MTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE
Formulation : Liquid in 6M guanidine hydrochloride,20mM Tris
Applications : SDS-PAGE, ELISA, Western blot
Storage : Store at 2-8°C for immediate use or -20°C for long term storage, avoid repeat freeze thaws.
Gene Name BMI1 BMI1 polycomb ring finger oncogene [ Homo sapiens ]
Synonyms BMI1; BMI1 polycomb ring finger oncogene; PCGF4; RNF51; FLVI2/BMI1; MGC12685; polycomb complex protein BMI-1; polycomb complex protein BMI-1; flvi-2/bmi-1; ring finger protein 51; polycomb group protein Bmi1; polycomb group RING finger protein 4; B lymphoma Mo-MLV insertion region 1 homolog; murine leukemia viral (bmi-1) oncogene homolog
Gene ID 648
mRNA Refseq NM_005180
Protein Refseq NP_005171
MIM 164831
UniProt ID P35226
Chromosome Location 10p11.23
Pathway Senescence and Autophagy; Transcriptional misregulation in cancer; Validated targets of C-MYC transcriptional activation
Function RING-like zinc finger domain binding; chromatin binding; protein binding; sequence-specific DNA binding; ubiquitin-protein ligase activity; zinc ion binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BMI1 Products

Required fields are marked with *

My Review for All BMI1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon