Recombinant Human Fas (TNFRSF6)-associated via death domain, His-tagged FADD-4351H

Recombinant Human Fas (TNFRSF6)-associated via death domain, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human Fas (TNFRSF6)-associated via death domain, His-tagged

Recombinant Human Fas (TNFRSF6)-associated via death domain, His-tagged

FADD Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : FADD-4351H
Product Overview : FADD produced in E.Coli is a single, non-glycosylated polypeptide chain containing 244 amino acids (1-208 a.a.) and having a molecular mass of 27.4 kDa. FADD is fused to 36 amino acid His-Tag at N-terminus and purified by proprietary chromatographic techniques.
Description : FADD is an adaptor protein that cooperates with a variety of cell surface receptors and mediates cell apoptotic signals. Using its C-terminal death domain, FADD is recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and consequently it take parts in the death signaling initiated by these receptors. FADD interaction with the receptors reviels the N-terminal effector domain of, which allows it to recruit caspase-8, and thus initiate the cysteine protease cascade. Knockout studies in mice furthermore propose the significance of FADD in premature T cell development. FADD plays a role in survival/proliferation and cell cycle development. FADD also takes part in cellular sublocalization, protein phosphorylation, and inhibitory molecules.
Source : Human
Host : Escherichia Coli
Form : The FADD protein solution contains 20mM Tris-HCl, pH-8, and 10% glycerol.
Purity : Greater than 95.0% as determined by SDS-PAGE.
Physical Appearance : Sterile Filtered White lyophilized (freeze-dried) powder.
Amino acid sequence : MRGSHHHHHHGMASMTGGQQM GRDLYDDDDKDRWGSMDPFLVLL HSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQND LEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVI CDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKN TEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWN SDAST SEAS
Storage : Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Pathways : Apoptosis; Toll-like receptor signaling pathway; Apoptosis
Functions : death receptor binding; identical protein binding
PDB renderingbased on 1a1w. :

Gene Name : FADD Fas (TNFRSF6)-associated via death domain [ Homo sapiens ]
Official Symbol : FADD
Synonyms : FADD; Fas (TNFRSF6)-associated via death domain; GIG3; MORT1; MGC8528; Fas-associated via death domain; growth-inhibiting gene 3 protein; mediator of receptor-induced toxicity; Fas-associating protein with death domain; Fas-associating death domain-containing protein; mediator of receptor-induced toxicity; Protein FADD; Mediator of receptor induced toxicity
Gene ID : 8772
mRNA Refseq : NM_003824
Protein Refseq : NP_003815
MIM : 602457
UniProt ID : Q13158
Chromosome Location : 11q13.3

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy