"UBE2M" Related Products

Expand

Recombinant Human Ubiquitin-Conjugating Enzyme E2M, His-tagged

Cat. No.: UBE2M-1501H
Product Overview: Ubiquitin Conjugating Enzyme E2M Human Recombinant produced in E.coli is a 25 kDa protein containing 216 amino acids. The UBE2M protein contains 6xHis tag and is purified by proprietary chromatographic techniques.
Description: UbcH12 is functional in in vitro NEDDylation reactions. It has been shown to form a thioester linkage with NEDD8 in the presence of the NEDD8 activating enzyme complex Uba3/APP-BP1. APP-BP1 binds to the amyloid precursor protein (APP) carboxy terminal domain and is important in conjunction with Uba3 and UbcH12 in driving cells through the S to M checkpoint. It was demonstrated to be the E2 responsible for the NEDDylation of the Cul-1 component of the SCF (?-TRCP) complex which is important as the E3-ligase in the ubiquitinylation of I?B?. NEDDylation of Cul-1 is essential for conjugation and processing of NF-?B p105 by SCF (?-TRCP) following phosphorylation of the complex. A dominant negative form of UbcH12, previously demonstrated to sequester NEDD8 and inhibit its conjugation, inhibits both conjugation and processing of p105, which is alleviated by wild-type UbcH12.
Source: Human
Host: Escherichia Coli.
Form: Lyophilized from a 0.2 μm filtered concentrated (1 mg/ml) solution in 1X PBS and 1 mM DTT, pH 7.5.
Purity: Greater than 95.0% as determined by (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Physical Appearance: Sterile Filtered white lyophilized powder.
Solubility: It is recommended to reconstitute the lyophilized UBE2M in sterile water not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Amino acid sequence: MSYYHHHHHHDYDIPTTENLYFQGAMDPEFRIWMIKLFSLKQQKKEEE SAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVIC PDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLN ILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAVLQNNRRLFEQNVQ RSMRGGYIGSTYFERCLK
Storage: Lyophilized UBE2M although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2M should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name: UBE2M ubiquitin-conjugating enzyme E2M [ Homo sapiens ]
Official Symbol: UBE2M
Synonyms: UBE2M; ubiquitin-conjugating enzyme E2M; UBC12; hUbc12; UBC-RS2; NEDD8-conjugating enzyme Ubc12 yeast UBC12 homolog; NEDD8 protein ligase; NEDD8 carrier protein; ubiquitin-protein ligase M; ubiquitin carrier protein M; ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast)
Gene ID: 9040
mRNA Refseq: NM_003969
Protein Refseq: NP_003960
MIM: 603173
UniProt ID: P61081
Chromosome Location: 19q13.43
Pathway: Adaptive Immunity Signaling; Antigen processing: Ubiquitination & Proteasome degradation; Class I MHC mediated antigen processing & presentation; Immune System; Ubiquitin mediated proteolysis
Function: ATP binding; NEDD8 ligase activity; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding; ribosomal S6-glutamic acid ligase activity; ubiquitin-protein ligase activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.