Recombinant Human UBE2M protein

Cat.No. : UBE2M-001H
Product Overview : Recombinant Human UBE2M protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 183
Description : The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin.
Form : 0.2μm Filtered concentrated solution in 50 mM HEPES, pH 6.5, with 125 mM NaCl, 10 % Glycerol, 5 % Trehalose, 1 mM DTT.
Molecular Mass : Approximately 20.9 kDa, a single non-glycosylated polypeptide chain containing 183 amino acids.
AA Sequence : MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Endotoxin : Less than 0.1 EU/µg of rHuUBE2M as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.
Gene Name UBE2M
Official Symbol UBE2M
Synonyms UBE2M; ubiquitin-conjugating enzyme E2M; ubiquitin conjugating enzyme E2M (homologous to yeast UBC12) , ubiquitin conjugating enzyme E2M (UBC12 homolog, yeast); NEDD8-conjugating enzyme Ubc12; hUbc12; UBC12; yeast UBC12 homolog; NEDD8 protein ligase; NEDD8 carrier protein; ubiquitin-protein ligase M; ubiquitin carrier protein M; ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast); UBC-RS2;
Gene ID 9040
mRNA Refseq NM_003969
Protein Refseq NP_003960
MIM 603173
UniProt ID P61081

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All UBE2M Products

Required fields are marked with *

My Review for All UBE2M Products

Required fields are marked with *

0
cart-icon