Recombinant Human UBE2M protein
| Cat.No. : | UBE2M-001H |
| Product Overview : | Recombinant Human UBE2M protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 183 |
| Description : | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin. |
| Form : | 0.2μm Filtered concentrated solution in 50 mM HEPES, pH 6.5, with 125 mM NaCl, 10 % Glycerol, 5 % Trehalose, 1 mM DTT. |
| Molecular Mass : | Approximately 20.9 kDa, a single non-glycosylated polypeptide chain containing 183 amino acids. |
| AA Sequence : | MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK |
| Endotoxin : | Less than 0.1 EU/µg of rHuUBE2M as determined by LAL method. |
| Purity : | >95% by SDS-PAGE and HPLC analysis. |
| Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening. |
| Gene Name | UBE2M |
| Official Symbol | UBE2M |
| Synonyms | UBE2M; ubiquitin-conjugating enzyme E2M; ubiquitin conjugating enzyme E2M (homologous to yeast UBC12) , ubiquitin conjugating enzyme E2M (UBC12 homolog, yeast); NEDD8-conjugating enzyme Ubc12; hUbc12; UBC12; yeast UBC12 homolog; NEDD8 protein ligase; NEDD8 carrier protein; ubiquitin-protein ligase M; ubiquitin carrier protein M; ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast); UBC-RS2; |
| Gene ID | 9040 |
| mRNA Refseq | NM_003969 |
| Protein Refseq | NP_003960 |
| MIM | 603173 |
| UniProt ID | P61081 |
| ◆ Recombinant Proteins | ||
| UBE2M-10HFL | Active Recombinant Full Length Human/Mouse/Rat ubiquitin conjugating enzyme E2 M Protein, Tag Free | +Inquiry |
| UBE2M-001H | Recombinant Human UBE2M protein | +Inquiry |
| UBE2M-857H | Recombinant Human UBE2M protein(Met1-Lys183) | +Inquiry |
| UBE2M-135H | Recombinant Human UBE2M, His-tagged | +Inquiry |
| UBE2M-6849H | Recombinant Human Ubiquitin-Conjugating Enzyme E2M, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| UBE2M-567HCL | Recombinant Human UBE2M 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UBE2M Products
Required fields are marked with *
My Review for All UBE2M Products
Required fields are marked with *
