| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
183 |
| Description : |
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin. |
| Form : |
0.2μm Filtered concentrated solution in 50 mM HEPES, pH 6.5, with 125 mM NaCl, 10 % Glycerol, 5 % Trehalose, 1 mM DTT. |
| Molecular Mass : |
Approximately 20.9 kDa, a single non-glycosylated polypeptide chain containing 183 amino acids. |
| AA Sequence : |
MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK |
| Endotoxin : |
Less than 0.1 EU/µg of rHuUBE2M as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening. |