Recombinant Human UBE2M protein

• Cat.No.: UBE2M-001H
• Product Overview: Recombinant Human UBE2M protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 183
• Description: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin.
• Form: 0.2μm Filtered concentrated solution in 50 mM HEPES, pH 6.5, with 125 mM NaCl, 10 % Glycerol, 5 % Trehalose, 1 mM DTT.
• Molecular Mass: Approximately 20.9 kDa, a single non-glycosylated polypeptide chain containing 183 amino acids.
• AA Sequence: MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
• Endotoxin: Less than 0.1 EU/µg of rHuUBE2M as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.

Gene Information

• Gene Name: UBE2M
• Official Symbol: UBE2M
• Synonyms: UBE2M; ubiquitin-conjugating enzyme E2M; ubiquitin conjugating enzyme E2M (homologous to yeast UBC12) , ubiquitin conjugating enzyme E2M (UBC12 homolog, yeast); NEDD8-conjugating enzyme Ubc12; hUbc12; UBC12; yeast UBC12 homolog; NEDD8 protein ligase; NEDD8 carrier protein; ubiquitin-protein ligase M; ubiquitin carrier protein M; ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast); UBC-RS2
• Gene ID: 9040
• mRNA Refseq: NM_003969
• Protein Refseq: NP_003960
• MIM: 603173
• UniProt ID: P61081