"CXCL12" Related Products

Expand
Expand

Recombinant Human CXCL12 protein

Cat.No. : CXCL12-01H
Product Overview : Recombinant Human CXCL12 alpha protein was expressed in Escherichia coli.
Description : CXCL12 also known as SDF-1 is belonging to the CXC chemokine family. It is encoded by the CXCL12 gene. In recently study, Human CXCL12 is expressed as six isoforms that differ only in the C-terminal tail. And all SDF-1 isoforms undergo proteolytic processing of the first two N-terminal amino acids. Contrast to the canonical sequence SDF-1β, SDF-1α is shorter by four amino acids at the C-terminal tail. On the cell surface, the receptor for this chemokine is CXCR4 and syndecan4. CXCL12 is strongly chemotactic for T-lymphocytes, monocytes, but not neutrophils. CXCL12 is a very important factor in carcinogenesis and the neovascularisation linked to tumor progression.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB pH 7.0, 130 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using PHA and rHuIL-2 activated human peripheral blood T-lymphocytes is in a concentration range of 20-80 ng/ml.
Molecular Mass : Approximately 8.0 kDa, a single non-glycosylated polypeptide chain containing 68 amino acids.
Protein length : 68
AA Sequence : KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Endotoxin : Less than 1 EU/μg of rHuSDF-1α/CXCL12α as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : CXCL12
Official Symbol : CXCL12
Synonyms : CXCL12; chemokine (C-X-C motif) ligand 12; SDF1, SDF1A, SDF1B, stromal cell derived factor 1; stromal cell-derived factor 1; PBSF; SCYB12; SDF 1a; SDF 1b; TLSF a; TLSF b; TPAR1; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor; IRH; SDF1; TLSF; SDF1A; SDF1B;
Gene ID : 6387
mRNA Refseq : NM_000609
Protein Refseq : NP_000600
MIM : 600835
UniProt ID : P48061

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.