Recombinant Full Length Human CXCL12 Protein, GST-tagged

Cat.No. : CXCL12-2279HF
Product Overview : Human CXCL12 full-length ORF ( AAH39893.1, 1 a.a. - 89 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 89 amino acids
Description : This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]
Molecular Mass : 35.53 kDa
AA Sequence : MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CXCL12 chemokine (C-X-C motif) ligand 12 [ Homo sapiens ]
Official Symbol CXCL12
Synonyms CXCL12; chemokine (C-X-C motif) ligand 12; SDF1, SDF1A, SDF1B, stromal cell derived factor 1; stromal cell-derived factor 1; PBSF; SCYB12; SDF 1a; SDF 1b; TLSF a; TLSF b; TPAR1; intercrine reduced in hepatomas; pre-B cell growth-stimulating factor; IRH; SDF1; TLSF; SDF1A; SDF1B
Gene ID 6387
mRNA Refseq NM_000609
Protein Refseq NP_000600
MIM 600835
UniProt ID P48061

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL12 Products

Required fields are marked with *

My Review for All CXCL12 Products

Required fields are marked with *

0
cart-icon
0
compare icon