"Fgf2" Related Products

Recombinant Mouse Fibroblast Growth Factor-basic

Cat.No.: Fgf2-12M
Product Overview: Approximately 16.2 kDa, a single non-glycosylated polypeptide chain containing 146 amino acids.
Description: FGF basic (FGF-2, HBGF-2) is one of at least 22 mitogenic proteins of the FGF family, which show 35-60% amino acid conservation. Unlike other FGFs, FGF acidic and basic lack signal peptides and are secreted by an alternate pathway. The 17 kDa mouse sequence has 98% aa identity with rat, and 95% identity with human, bovine and sheep FGF basic. Binding of FGF to heparin or cell surface HSPG is necessary for binding, dimerization and activation of tyrosine kinase FGF receptors. FGF basic binds other proteins, polysaccharides and lipids with lower affinity. Expression of FGF basic is nearly ubiquitous but disruption of the mouse FGF basic gene gives a relatively mild phenotype, suggesting compensation by other FGF family members. FGF basic modulates such normal processes as angiogenesis, wound healing and tissue repair, embryonic development and differentiation, neuronal function and neural degeneration. Transgenic overexpression of FGF basic results in excessive proliferation and angiogenesis reminiscent of a variety of pathological conditions.
Source: E.coli
Species: Mouse
Form: Sterile Filtered White lyophilized (freeze-dried) powder. Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
Bio-activity: Fully biologically active when compared to standard. The ED50 determined by a cell proliferation assay using murine NR6R/3T3 cells is less than 1.8 ng/ml, corresponding to a specific activity of > 5.6 × 10~5 IU/mg
Molecular Mass: 16.2 kDa
Protein length: 146aa
AA Sequence: MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLA MKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Endotoxin: Less than 1EU/μg of rMubFGF as determined by LAL method.
Purity: >98% by SDS-PAGE and HPLC analyses.
Storage: This lyophilized preparation is stable at 2-8°C, but should be kept at -20°C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8°C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20°C to -70°C. Avoid repeated freeze/thaw cycles.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
Gene Name: Fgf2 fibroblast growth factor 2 [ Mus musculus ]
Official Symbol: Fgf2
Synonyms: FGF2; fibroblast growth factor 2; HBGF-2; basic fibroblast growth factor; heparin-binding growth factor 2; Fgfb; bFGF; Fgf-2;
Gene ID: 14173
mRNA Refseq: NM_008006
Protein Refseq: NP_032032
Pathway: Downstream signaling of activated FGFR, organism-specific biosystem; ESC Pluripotency Pathways, organism-specific biosystem; Endochondral Ossification, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; FGFR1 ligand binding and activation, organism-specific biosystem; FGFR1b ligand binding and activation, organism-specific biosystem; FGFR1c ligand binding and activation, organism-specific biosystem;
Function: chemoattractant activity; cytokine activity; fibroblast growth factor binding; fibroblast growth factor receptor binding; fibroblast growth factor receptor binding; growth factor activity; growth factor activity; heparin binding; ligand-dependent nuclear receptor transcription coactivator activity; protein binding; voltage-gated calcium channel activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.