Recombinant Cynomolgus IL6R, His-tagged
Cat.No. : | IL6R-9166H |
Product Overview : | Recombinant Cynomolgus IL6R protein, a DNA sequence encoding the extracellular domain of Cynomolgus IL6R corresponding to amino acid (1-358) was expressed with a C-terminal polyhistidine tag in HEK293. |
Availability | May 25, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Macaca mulatta |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-358 a.a. |
Description : | Interleukin 6 (IL6) is a potent pleiotropic cytokine that regulates cell growth and differentiation of various tissues, and is known particularly for its role in the immune response and acute phase reactions. The IL6 receptor is composed of two different subunits, IL6R that binds IL6 with low affinity, and ubiquitously expressed Glycoprotein 130 (gp130) which acts as a common signal-transducing receptor and binds the IL-6·IL-6R complex with high affinity. The IL6R, also known as CD126, is a type I transmembrane cytokine receptor and lacks a tyrosine/kinase domain within the cytoplasmic region, unlike other growth factor receptors. The soluble form of IL6R arises from proteolytic cleavage of membrane-bound IL6Rα, and acts agonistically by making the IL6 ligand accessible to the signal transducer gp130. Dysregulated production of IL6 and IL6R are implicated in the pathogenesis of several inflammatory diseases and malignancies such as multiple myeloma, rheumatoid arthritis, or osteoporosis, and it has been reported that a humanized anti-IL6R monoclonal antibody is a promising agent applicable to the therapeutic approach for IL6 driven diseases. |
Form : | Lyophilized. 25 mM Tris-HCl, pH7.4, 300 mM NaCl, 1 mM DTT, 5%Trehalose |
Molecular Mass : | The soluble form of recombinant Cynomolgus IL6R consists of 358 amino acids and has a predicted molecular mass of 40kDa. In SDS-PAGE under reducing conditions, it migrates with an apparent molecular mass of 60-65 kDa due to glycosylation. |
AA Sequence : | MLAVGCALLAALLATPGAALAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAEGSHLSRWA GVGRRLLLRSVQLHDSGNYSCYRAGRPAATVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSPTTKAVLLV RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKLSKTQTFQGCGILQPDPPANITVT AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ GEWSEWSPEAMGTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSGDSANATSLPVQD |
Purity : | >90% as determined by SDS-PAGE |
Storage : | Store it at +4℃ for short term. For long term storage, store it at -20℃ ~ -70℃ |
Reconstitution : | It is recommended to reconstitute the lyophilized Cynomolgus CD126 in 0.1ml sterile and pre-cooled ddH2O, which can then be further diluted to other aqueous solutions. |
Gene Name | IL6R interleukin 6 receptor [ Macaca mulatta ] |
Official Symbol | IL6R |
Synonyms | IL6R; interleukin 6 receptor; Ensembl:ENSMMUG00000022978; interleukin-6 receptor subunit alpha; |
Gene ID | 716690 |
Pathway | Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; HIF-1 signaling pathway, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
◆ Recombinant Proteins | ||
IL6R-3154H | Recombinant Human IL6R Protein, His (Fc)-Avi-tagged | +Inquiry |
IL6R-200H | Active Recombinant Human IL6R, MIgG2a Fc-tagged | +Inquiry |
IL6R-584H | Active Recombinant Human IL6R Protein | +Inquiry |
IL6R-786H | Active Recombinant Human IL6R protein, His-tagged | +Inquiry |
IL6R-139I | Active Recombinant Human IL6R Protein (350 aa), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6R-2903HCL | Recombinant Human IL6R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL6R Products
Required fields are marked with *
My Review for All IL6R Products
Required fields are marked with *
0
Inquiry Basket