Recombinant Cynomolgus IL6R, His-tagged

Cat.No. : IL6R-9166H
Product Overview : Recombinant Cynomolgus IL6R protein, a DNA sequence encoding the extracellular domain of Cynomolgus IL6R corresponding to amino acid (1-358) was expressed with a C-terminal polyhistidine tag in HEK293.
Availability November 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Macaca mulatta
Source : HEK293
Tag : His
Protein Length : 1-358 a.a.
Description : Interleukin 6 (IL6) is a potent pleiotropic cytokine that regulates cell growth and differentiation of various tissues, and is known particularly for its role in the immune response and acute phase reactions. The IL6 receptor is composed of two different subunits, IL6R that binds IL6 with low affinity, and ubiquitously expressed Glycoprotein 130 (gp130) which acts as a common signal-transducing receptor and binds the IL-6·IL-6R complex with high affinity. The IL6R, also known as CD126, is a type I transmembrane cytokine receptor and lacks a tyrosine/kinase domain within the cytoplasmic region, unlike other growth factor receptors. The soluble form of IL6R arises from proteolytic cleavage of membrane-bound IL6Rα, and acts agonistically by making the IL6 ligand accessible to the signal transducer gp130. Dysregulated production of IL6 and IL6R are implicated in the pathogenesis of several inflammatory diseases and malignancies such as multiple myeloma, rheumatoid arthritis, or osteoporosis, and it has been reported that a humanized anti-IL6R monoclonal antibody is a promising agent applicable to the therapeutic approach for IL6 driven diseases.
Form : Lyophilized. 25 mM Tris-HCl, pH7.4, 300 mM NaCl, 1 mM DTT, 5%Trehalose
Molecular Mass : The soluble form of recombinant Cynomolgus IL6R consists of 358 amino acids and has a predicted molecular mass of 40kDa. In SDS-PAGE under reducing conditions, it migrates with an apparent molecular mass of 60-65 kDa due to glycosylation.
AA Sequence : MLAVGCALLAALLATPGAALAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAEGSHLSRWA GVGRRLLLRSVQLHDSGNYSCYRAGRPAATVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSPTTKAVLLV RKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKLSKTQTFQGCGILQPDPPANITVT AVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ GEWSEWSPEAMGTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSGDSANATSLPVQD
Purity : >90% as determined by SDS-PAGE
Storage : Store it at +4℃ for short term. For long term storage, store it at -20℃ ~ -70℃
Reconstitution : It is recommended to reconstitute the lyophilized Cynomolgus CD126 in 0.1ml sterile and pre-cooled ddH2O, which can then be further diluted to other aqueous solutions.
Gene Name IL6R interleukin 6 receptor [ Macaca mulatta ]
Official Symbol IL6R
Synonyms IL6R; interleukin 6 receptor; Ensembl:ENSMMUG00000022978; interleukin-6 receptor subunit alpha;
Gene ID 716690
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; HIF-1 signaling pathway, organism-specific biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL6R Products

Required fields are marked with *

My Review for All IL6R Products

Required fields are marked with *

0
cart-icon
0
compare icon