Recombinant Human ATXN3L protein, GST-tagged
| Cat.No. : | ATXN3L-10070H |
| Product Overview : | Recombinant Human ATXN3L protein(271-341 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | October 30, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 271-341 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | CVTPASEQPKKIKEDYFEKHQQEQKQQQQQSDLPGHSSYLHERPTTSSRAIESDLSDDISEDTVQAAVDTI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| MIM-Weblink : |
| Gene Name | ATXN3L ataxin 3-like [ Homo sapiens ] |
| Official Symbol | ATXN3L |
| Synonyms | ataxin 3-like; ATX3L; MJDL; EC 3.4.19.12; Machado-Joseph disease protein 1-like; EC 3.4.22; putative ataxin-3-like protein |
| Gene ID | 92552 |
| mRNA Refseq | NM_001135995.1 |
| Protein Refseq | NP_001129467.1 |
| UniProt ID | B4DYC7 |
| ◆ Recombinant Proteins | ||
| ATXN3L-164H | Recombinant Human ATXN3L, His-tagged | +Inquiry |
| ATXN3L-174H | Active Recombinant Human ATXN3L, His-tagged | +Inquiry |
| ATXN3L-1071H | Recombinant Human ATXN3L protein, His-tagged | +Inquiry |
| ATXN3L-10070H | Recombinant Human ATXN3L protein, GST-tagged | +Inquiry |
| ATXN3L-0373H | Recombinant Human ATXN3L Protein (D2-K355), Flag tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATXN3L Products
Required fields are marked with *
My Review for All ATXN3L Products
Required fields are marked with *
