Recombinant Human ATXN3L protein, GST-tagged

Cat.No. : ATXN3L-10070H
Product Overview : Recombinant Human ATXN3L protein(271-341 aa), fused with N-terminal GST tag, was expressed in E.coli.
Availability July 29, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 271-341 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
AASequence : CVTPASEQPKKIKEDYFEKHQQEQKQQQQQSDLPGHSSYLHERPTTSSRAIESDLSDDISEDTVQAAVDTI
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
MIM-Weblink :  
Gene Name ATXN3L ataxin 3-like [ Homo sapiens ]
Official Symbol ATXN3L
Synonyms ataxin 3-like; ATX3L; MJDL; EC 3.4.19.12; Machado-Joseph disease protein 1-like; EC 3.4.22; putative ataxin-3-like protein
Gene ID 92552
mRNA Refseq NM_001135995.1
Protein Refseq NP_001129467.1
UniProt ID B4DYC7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATXN3L Products

Required fields are marked with *

My Review for All ATXN3L Products

Required fields are marked with *

0
cart-icon
0
compare icon