Recombinant Human IGF2BP3 protein, GST-tagged

• Cat.No.: IGF2BP3-14103H
• Product Overview: Recombinant Human IGF2BP3 protein(240-579 aa), fused with GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 240-579 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: IGF2BP3 insulin-like growth factor 2 mRNA binding protein 3 [ Homo sapiens ]
• Official Symbol: IGF2BP3
• Synonyms: IGF2BP3; insulin-like growth factor 2 mRNA binding protein 3; insulin-like growth factor 2 mRNA-binding protein 3; cancer/testis antigen 98; CT98; IGF II mRNA binding protein 3; IMP 3; hKOC; VICKZ family member 3; IGF2 mRNA-binding protein 3; IGF-II mRNA-binding protein 3; KH domain containing protein overexpressed in cancer; KH domain-containing protein overexpressed in cancer; IMP3; KOC1; IMP-3; VICKZ3; DKFZp686F1078
• Gene ID: 10643
• mRNA Refseq: NM_006547
• Protein Refseq: NP_006538
• MIM: 608259
• UniProt ID: O00425