Recombinant Human IGF2BP3 protein, GST-tagged

Cat.No. : IGF2BP3-14103H
Product Overview : Recombinant Human IGF2BP3 protein(240-579 aa), fused with GST tag, was expressed in E.coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 240-579 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQELTLYNPERTITVKGNVETCAKAEEEIMKKIRESYENDIASMNLQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENFVSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKITGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name IGF2BP3 insulin-like growth factor 2 mRNA binding protein 3 [ Homo sapiens ]
Official Symbol IGF2BP3
Synonyms IGF2BP3; insulin-like growth factor 2 mRNA binding protein 3; insulin-like growth factor 2 mRNA-binding protein 3; cancer/testis antigen 98; CT98; IGF II mRNA binding protein 3; IMP 3; hKOC; VICKZ family member 3; IGF2 mRNA-binding protein 3; IGF-II mRNA-binding protein 3; KH domain containing protein overexpressed in cancer; KH domain-containing protein overexpressed in cancer; IMP3; KOC1; IMP-3; VICKZ3; DKFZp686F1078;
Gene ID 10643
mRNA Refseq NM_006547
Protein Refseq NP_006538
MIM 608259
UniProt ID O00425

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IGF2BP3 Products

Required fields are marked with *

My Review for All IGF2BP3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon