"DUSP16" Related Products

Recombinant Human DUSP16, GST-tagged

Cat.No.: DUSP16-101H
Product Overview: Human DUSP16 partial ORF (561 a.a. - 665 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a mitogen-activated protein kinase phosphatase that is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. The encoded protein specifically regulates the c-Jun amino-terminal kinase (JNK) and extracellular signal-regulated kinase (ERK) pathways.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 37.29 kDa
AA Sequence: TESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRRQKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGES IMSENRSREELGKVGSQSSFSGSMEIIEVS
Applications: ELISA; WB; Antibody Production; Protein Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: DUSP16 dual specificity phosphatase 16 [ Homo sapiens (human) ]
Official Symbol: DUSP16
Synonyms: DUSP16; MKP7; MKP-7; dual specificity phosphatase 16; MAPK phosphatase-7; MAP kinase phosphatase 7; mitogen-activated protein kinase phosphatase 7; EC 3.1.3.16; EC 3.1.3.48
Gene ID: 80824
mRNA Refseq: NM_030640
Protein Refseq: NP_085143
MIM: 607175
UniProt ID: Q9BY84
Chromosome Location: 12p13
Pathway: MAPK signaling pathway; Regulation of p38-alpha and p38-beta
Function: MAP kinase tyrosine/serine/threonine phosphatase activity; phosphoprotein phosphatase activity; protein tyrosine phosphatase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.