Recombinant Human DUSP16, GST-tagged

Cat.No. : DUSP16-101H
Product Overview : Human DUSP16 partial ORF (561 a.a. - 665 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a mitogen-activated protein kinase phosphatase that is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. The encoded protein specifically regulates the c-Jun amino-terminal kinase (JNK) and extracellular signal-regulated kinase (ERK) pathways.
Molecular Mass : 37.29 kDa
AA Sequence : TESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRRQKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGES IMSENRSREELGKVGSQSSFSGSMEIIEVS
Applications : ELISA; WB; Antibody Production; Protein Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DUSP16 dual specificity phosphatase 16 [ Homo sapiens (human) ]
Official Symbol DUSP16
Synonyms DUSP16; MKP7; MKP-7; dual specificity phosphatase 16; MAPK phosphatase-7; MAP kinase phosphatase 7; mitogen-activated protein kinase phosphatase 7; EC 3.1.3.16; EC 3.1.3.48
Gene ID 80824
mRNA Refseq NM_030640
Protein Refseq NP_085143
MIM 607175
UniProt ID Q9BY84
Chromosome Location 12p13
Pathway MAPK signaling pathway; Regulation of p38-alpha and p38-beta
Function MAP kinase tyrosine/serine/threonine phosphatase activity; phosphoprotein phosphatase activity; protein tyrosine phosphatase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DUSP16 Products

Required fields are marked with *

My Review for All DUSP16 Products

Required fields are marked with *

0
cart-icon