Recombinant Human DUSP16, GST-tagged
| Cat.No. : | DUSP16-101H |
| Product Overview : | Human DUSP16 partial ORF (561 a.a. - 665 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a mitogen-activated protein kinase phosphatase that is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. The encoded protein specifically regulates the c-Jun amino-terminal kinase (JNK) and extracellular signal-regulated kinase (ERK) pathways. |
| Molecular Mass : | 37.29 kDa |
| AA Sequence : | TESSHFYSASAIYGGSASYSAYSCSQLPTCGDQVYSVRRRQKPSDRADSRRSWHEESPFEKQFKRRSCQMEFGES IMSENRSREELGKVGSQSSFSGSMEIIEVS |
| Applications : | ELISA; WB; Antibody Production; Protein Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DUSP16 dual specificity phosphatase 16 [ Homo sapiens (human) ] |
| Official Symbol | DUSP16 |
| Synonyms | DUSP16; MKP7; MKP-7; dual specificity phosphatase 16; MAPK phosphatase-7; MAP kinase phosphatase 7; mitogen-activated protein kinase phosphatase 7; EC 3.1.3.16; EC 3.1.3.48 |
| Gene ID | 80824 |
| mRNA Refseq | NM_030640 |
| Protein Refseq | NP_085143 |
| MIM | 607175 |
| UniProt ID | Q9BY84 |
| Chromosome Location | 12p13 |
| Pathway | MAPK signaling pathway; Regulation of p38-alpha and p38-beta |
| Function | MAP kinase tyrosine/serine/threonine phosphatase activity; phosphoprotein phosphatase activity; protein tyrosine phosphatase activity |
| ◆ Recombinant Proteins | ||
| DUSP16-102H | Recombinant Human DUSP16, GST-tagged | +Inquiry |
| DUSP16-101H | Recombinant Human DUSP16, GST-tagged | +Inquiry |
| DUSP16-12442Z | Recombinant Zebrafish DUSP16 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DUSP16 Products
Required fields are marked with *
My Review for All DUSP16 Products
Required fields are marked with *
