Recombinant Human PRG2, His-tagged

Cat.No. : PRG2-44H
Product Overview : Recombinant Human Bone Marrow Proteoglycan/BMPG is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu17-Tyr222) of Human PRG2 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 17-222 a.a.
Description : Bone Marrow Proteoglycan (BMPG) is a secreted protein that contains one C-type lectin domain. BMPG is the predominant constituent of the crystalline core of the eosinophil granule. BMPG is highly expressed in placenta and pregnancy serum. BMPG may be involved in antiparasitic defense mechanisms as a cytotoxin and helminthotoxin. BMPG induces non-cytolytic histamine release from human basophils. In addition, BMPG also participated in antiparasitic defense mechanisms and immune hypersensitivity reactions.
AA Sequence : LHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKKDGAVESISVPD MVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQ CSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGYWRRAH CLRRLPFICSYVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name PRG2 proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein) [ Homo sapiens ]
Official Symbol PRG2
Synonyms PRG2; proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein); bone marrow proteoglycan; BMPG; MBP; bone-marrow proteoglycan; proteoglycan 2 preproprotein; natural killer cell activator; eosinophil major basic protein; eosinophil granule major basic protein; MBP1; MGC14537;
Gene ID 5553
mRNA Refseq NM_001243245
Protein Refseq NP_001230174
MIM 605601
UniProt ID P13727
Chromosome Location 11q12
Pathway Asthma, organism-specific biosystem; Asthma, conserved biosystem;
Function binding; heparin binding; sugar binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRG2 Products

Required fields are marked with *

My Review for All PRG2 Products

Required fields are marked with *

0
cart-icon