Recombinant Human PRG2 protein, His-SUMO-tagged
Cat.No. : | PRG2-2390H |
Product Overview : | Recombinant Human PRG2 protein(P13727)(106-222aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 106-222aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.8 kDa |
AA Sequence : | TCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PRG2 proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein) [ Homo sapiens ] |
Official Symbol | PRG2 |
Synonyms | PRG2; proteoglycan 2, bone marrow (natural killer cell activator, eosinophil granule major basic protein); bone marrow proteoglycan; BMPG; MBP; bone-marrow proteoglycan; proteoglycan 2 preproprotein; natural killer cell activator; eosinophil major basic protein; eosinophil granule major basic protein; MBP1; MGC14537; |
Gene ID | 5553 |
mRNA Refseq | NM_001243245 |
Protein Refseq | NP_001230174 |
MIM | 605601 |
UniProt ID | P13727 |
◆ Recombinant Proteins | ||
PRG2-19H | Recombinant Human PRG2 Protein (Leu17-End), N-His-ABP tagged | +Inquiry |
PRG2-44H | Recombinant Human PRG2, His-tagged | +Inquiry |
Prg2-1746M | Recombinant Mouse Prg2 protein, His & GST-tagged | +Inquiry |
PRG2-5978H | Recombinant Human PRG2 Protein (Thr106-Tyr222), N-His tagged | +Inquiry |
PRG2-45H | Recombinant Human PRG2, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRG2-2872HCL | Recombinant Human PRG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRG2 Products
Required fields are marked with *
My Review for All PRG2 Products
Required fields are marked with *
0
Inquiry Basket