Recombinant Human CHST14, His-tagged

• Cat.No.: CHST14-100H
• Product Overview: Recombinant Human Carbohydrate Sulfotransferase 14/CHST14 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu61-Gln376) of Human CHST14 fused with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 61-376 a.a.
• Description: Carbohydrate Sulfotransferase 14 (CHST14) is a single-pass type II membrane protein member of the sulfotransferase 2 family. CHST14 is widely expressed and at high levels in pituitary gland, placenta, uterus and thyroid. CHST14 plays a pivotal role in the formation of 4-0-sulfated IdoA blocks in dermatan sulfate and the cerbellar neural network during postnatal brain development. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. CHST14 transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. The CHST14 transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA sequences.
• AA Sequence: ERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQP GMPR DPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVMKVLAGVLDSVDVRL KMDHRSDL VFLADLRPEEIRYRLQHYFKFLFVREPLERLLSAYRNKFGEIREYQQRYGAE IVRRYRAGAGPS PAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYE RLEADANQVLEWVRAP PHVRFPARQAWYRPASPESLHYHLCSAPRALLQDVLPKYILDFS LFAYPLPNVTKEACQQVDHH HHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.

Gene Information

• Gene Name: CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 [ Homo sapiens ]
• Official Symbol: CHST14
• Synonyms: CHST14; carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14; D4ST1, dermatan 4 sulfotransferase 1; carbohydrate sulfotransferase 14; D4ST 1; HD4ST; dermatan 4 sulfotransferase 1; ATCS; D4ST1; HNK1ST
• Gene ID: 113189
• mRNA Refseq: NM_130468
• Protein Refseq: NP_569735
• MIM: 608429
• UniProt ID: Q8NCH0
• Chromosome Location: 15q15.1
• Pathway: Glycosaminoglycan biosynthesis - chondroitin sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - chondroitin sulfate, conserved biosystem; dermatan sulfate biosynthesis, organism-specific biosystem; dermatan sulfate biosynthesis, conserved biosystem; dermatan sulfate biosynthesis (late stages), organism-specific biosystem; dermatan sulfate biosynthesis (late stages), conserved biosystem; metapathway biotransformation, organism-specific biosystem
• Function: N-acetylgalactosamine 4-O-sulfotransferase activity; phosphate ion binding; transferase activity