Recombinant Human CHST14, His-tagged CHST14-100H

Recombinant Human CHST14, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CHST14, His-tagged

Recombinant Human CHST14, His-tagged

CHST14 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CHST14-100H
Product Overview : Recombinant Human Carbohydrate Sulfotransferase 14/CHST14 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu61-Gln376) of Human CHST14 fused with a 6His tag at the C-terminus.
Description : Carbohydrate Sulfotransferase 14 (CHST14) is a single-pass type II membrane protein member of the sulfotransferase 2 family. CHST14 is widely expressed and at high levels in pituitary gland, placenta, uterus and thyroid. CHST14 plays a pivotal role in the formation of 4-0-sulfated IdoA blocks in dermatan sulfate and the cerbellar neural network during postnatal brain development. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. CHST14 transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. The CHST14 transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA sequences.
Source : HEK293
Species : Human
Tag : His
AA Sequence : ERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQP GMPR DPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVMKVLAGVLDSVDVRL KMDHRSDL VFLADLRPEEIRYRLQHYFKFLFVREPLERLLSAYRNKFGEIREYQQRYGAE IVRRYRAGAGPS PAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYE RLEADANQVLEWVRAP PHVRFPARQAWYRPASPESLHYHLCSAPRALLQDVLPKYILDFS LFAYPLPNVTKEACQQVDHH HHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name : CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 [ Homo sapiens ]
Official Symbol : CHST14
Synonyms : CHST14; carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14; D4ST1, dermatan 4 sulfotransferase 1; carbohydrate sulfotransferase 14; D4ST 1; HD4ST; dermatan 4 sulfotransferase 1; ATCS; D4ST1; HNK1ST;
Gene ID : 113189
mRNA Refseq : NM_130468
Protein Refseq : NP_569735
MIM : 608429
UniProt ID : Q8NCH0
Chromosome Location : 15q15.1
Pathway : Glycosaminoglycan biosynthesis - chondroitin sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - chondroitin sulfate, conserved biosystem; dermatan sulfate biosynthesis, organism-specific biosystem; dermatan sulfate biosynthesis, conserved biosystem; dermatan sulfate biosynthesis (late stages), organism-specific biosystem; dermatan sulfate biosynthesis (late stages), conserved biosystem; metapathway biotransformation, organism-specific biosystem;
Function : N-acetylgalactosamine 4-O-sulfotransferase activity; phosphate ion binding; transferase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy