Recombinant Human CHST14, His-tagged

Cat.No. : CHST14-100H
Product Overview : Recombinant Human Carbohydrate Sulfotransferase 14/CHST14 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu61-Gln376) of Human CHST14 fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 61-376 a.a.
Description : Carbohydrate Sulfotransferase 14 (CHST14) is a single-pass type II membrane protein member of the sulfotransferase 2 family. CHST14 is widely expressed and at high levels in pituitary gland, placenta, uterus and thyroid. CHST14 plays a pivotal role in the formation of 4-0-sulfated IdoA blocks in dermatan sulfate and the cerbellar neural network during postnatal brain development. CHST14 catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of dermatan sulfate. CHST14 transfers sulfate to the C-4 hydroxyl of beta1,4-linked GalNAc that is substituted with an alpha-linked iduronic acid (IdoUA) at the C-3 hydroxyl. The CHST14 transfers sulfate more efficiently to GalNAc residues in -IdoUA-GalNAc-IdoUA- than in -GlcUA-GalNAc-GlcUA sequences.
AA Sequence : ERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQP GMPR DPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVMKVLAGVLDSVDVRL KMDHRSDL VFLADLRPEEIRYRLQHYFKFLFVREPLERLLSAYRNKFGEIREYQQRYGAE IVRRYRAGAGPS PAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYE RLEADANQVLEWVRAP PHVRFPARQAWYRPASPESLHYHLCSAPRALLQDVLPKYILDFS LFAYPLPNVTKEACQQVDHH HHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 [ Homo sapiens ]
Official Symbol CHST14
Synonyms CHST14; carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14; D4ST1, dermatan 4 sulfotransferase 1; carbohydrate sulfotransferase 14; D4ST 1; HD4ST; dermatan 4 sulfotransferase 1; ATCS; D4ST1; HNK1ST;
Gene ID 113189
mRNA Refseq NM_130468
Protein Refseq NP_569735
MIM 608429
UniProt ID Q8NCH0
Chromosome Location 15q15.1
Pathway Glycosaminoglycan biosynthesis - chondroitin sulfate, organism-specific biosystem; Glycosaminoglycan biosynthesis - chondroitin sulfate, conserved biosystem; dermatan sulfate biosynthesis, organism-specific biosystem; dermatan sulfate biosynthesis, conserved biosystem; dermatan sulfate biosynthesis (late stages), organism-specific biosystem; dermatan sulfate biosynthesis (late stages), conserved biosystem; metapathway biotransformation, organism-specific biosystem;
Function N-acetylgalactosamine 4-O-sulfotransferase activity; phosphate ion binding; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHST14 Products

Required fields are marked with *

My Review for All CHST14 Products

Required fields are marked with *

0
cart-icon