Recombinant Human CHST14 Protein, GST-tagged
| Cat.No. : | CHST14-1341H |
| Product Overview : | Human CHST14 full-length ORF ( NP_569735.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the HNK-1 family of sulfotransferases. The encoded protein transfers sulfate to the C-4 hydroxyl of N-acetylgalactosamine residues in dermatan sulfate. Mutations in this gene have been associated with adducted thumb-clubfoot syndrome.[provided by RefSeq, Mar 2010] |
| Molecular Mass : | 69.4 kDa |
| AA Sequence : | MFPRPLTPLAAPNGAEPLGRALRRAPLGRARAGLGGPPLLLPSMLMFAVIVASSGLLLMIERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVMKVLAGVLDSVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVREPLERLLSAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYERLEADANQVLEWVRAPPHVRFPARQAWYRPASPESLHYHLCSAPRALLQDVLPKYILDFSLFAYPLPNVTKEACQQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 [ Homo sapiens ] |
| Official Symbol | CHST14 |
| Synonyms | CHST14; carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14; D4ST1, dermatan 4 sulfotransferase 1; carbohydrate sulfotransferase 14; D4ST 1; HD4ST; dermatan 4 sulfotransferase 1; ATCS; D4ST1; HNK1ST; |
| Gene ID | 113189 |
| mRNA Refseq | NM_130468 |
| Protein Refseq | NP_569735 |
| MIM | 608429 |
| UniProt ID | Q8NCH0 |
| ◆ Recombinant Proteins | ||
| CHST14-1341H | Recombinant Human CHST14 Protein, GST-tagged | +Inquiry |
| CHST14-12095Z | Recombinant Zebrafish CHST14 | +Inquiry |
| CHST14-1673M | Recombinant Mouse CHST14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CHST14-100H | Recombinant Human CHST14, His-tagged | +Inquiry |
| CHST14-3449M | Recombinant Mouse CHST14 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHST14 Products
Required fields are marked with *
My Review for All CHST14 Products
Required fields are marked with *



