Recombinant Human CHST14 Protein, GST-tagged

Cat.No. : CHST14-1341H
Product Overview : Human CHST14 full-length ORF ( NP_569735.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the HNK-1 family of sulfotransferases. The encoded protein transfers sulfate to the C-4 hydroxyl of N-acetylgalactosamine residues in dermatan sulfate. Mutations in this gene have been associated with adducted thumb-clubfoot syndrome.[provided by RefSeq, Mar 2010]
Molecular Mass : 69.4 kDa
AA Sequence : MFPRPLTPLAAPNGAEPLGRALRRAPLGRARAGLGGPPLLLPSMLMFAVIVASSGLLLMIERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVMKVLAGVLDSVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVREPLERLLSAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYERLEADANQVLEWVRAPPHVRFPARQAWYRPASPESLHYHLCSAPRALLQDVLPKYILDFSLFAYPLPNVTKEACQQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 [ Homo sapiens ]
Official Symbol CHST14
Synonyms CHST14; carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14; D4ST1, dermatan 4 sulfotransferase 1; carbohydrate sulfotransferase 14; D4ST 1; HD4ST; dermatan 4 sulfotransferase 1; ATCS; D4ST1; HNK1ST;
Gene ID 113189
mRNA Refseq NM_130468
Protein Refseq NP_569735
MIM 608429
UniProt ID Q8NCH0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CHST14 Products

Required fields are marked with *

My Review for All CHST14 Products

Required fields are marked with *

0
cart-icon