Recombinant Human CHST14 Protein, GST-tagged
Cat.No. : | CHST14-1341H |
Product Overview : | Human CHST14 full-length ORF ( NP_569735.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the HNK-1 family of sulfotransferases. The encoded protein transfers sulfate to the C-4 hydroxyl of N-acetylgalactosamine residues in dermatan sulfate. Mutations in this gene have been associated with adducted thumb-clubfoot syndrome.[provided by RefSeq, Mar 2010] |
Molecular Mass : | 69.4 kDa |
AA Sequence : | MFPRPLTPLAAPNGAEPLGRALRRAPLGRARAGLGGPPLLLPSMLMFAVIVASSGLLLMIERGILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPVGQRRTLLRHILVSDRYRFLYCYVPKVACSNWKRVMKVLAGVLDSVDVRLKMDHRSDLVFLADLRPEEIRYRLQHYFKFLFVREPLERLLSAYRNKFGEIREYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWMPVYHLCQPCAVHYDFVGSYERLEADANQVLEWVRAPPHVRFPARQAWYRPASPESLHYHLCSAPRALLQDVLPKYILDFSLFAYPLPNVTKEACQQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CHST14 carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14 [ Homo sapiens ] |
Official Symbol | CHST14 |
Synonyms | CHST14; carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14; D4ST1, dermatan 4 sulfotransferase 1; carbohydrate sulfotransferase 14; D4ST 1; HD4ST; dermatan 4 sulfotransferase 1; ATCS; D4ST1; HNK1ST; |
Gene ID | 113189 |
mRNA Refseq | NM_130468 |
Protein Refseq | NP_569735 |
MIM | 608429 |
UniProt ID | Q8NCH0 |
◆ Recombinant Proteins | ||
CHST14-100H | Recombinant Human CHST14, His-tagged | +Inquiry |
CHST14-12095Z | Recombinant Zebrafish CHST14 | +Inquiry |
CHST14-1831HF | Recombinant Full Length Human CHST14 Protein, GST-tagged | +Inquiry |
CHST14-1673M | Recombinant Mouse CHST14 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHST14-1341H | Recombinant Human CHST14 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CHST14 Products
Required fields are marked with *
My Review for All CHST14 Products
Required fields are marked with *
0
Inquiry Basket