"masp1" Related Products

Expand
Expand

Recombinant Human MASP1, His-tagged

Cat.No.: MASP1-137H
Product Overview: Recombinant Human Mannan-Binding Lectin Serine Protease 1/MASP1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (His20-Arg728) of Human MASP1 fused with a polyhistidine tag at the C-terminus.
Description: Mannan-Binding Lectin Serine Protease 1 (MASP-1) belongs to the peptidase S1 family. MASP1 contains two CUB domains, one EGF-like domain, one peptidase S1 domain and two Sushi (CCP/SCR) domains. MASP1 is primarily expressed in liver. MASP1 involved in the lectin pathway of the complement, performs a key role in innate immunity by recognizing pathogens through patterns of sugar moieties and neutralizing them. MASP1 is synthesized as a zymogen and activated when it complexes with the pathogen recognition molecules of lectin pathway, the mannose-binding lectin and the ficolins. MASP1 is not directly involved in complement activation but may act as an amplifier of complement activation by cleaving complement C2 or by activating another complement serine protease, MASP2. MASP1 is also able to cleave fibrinogen and factor XIII and may may be involved in coagulation. MASP1 is inhibited by SERPING1 and A2M.
Source: HEK293
Species: Human
Tag: His
AA Sequence: HTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEYDYVKVETED QVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDE ELSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLY TIELEEGFMVNLQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILF HSDNSGENRGWRLSYRAAGNECPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDT FQIECLKDGTWSNKIPTCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNT GIYTCSAQGVWMNKVLGRSLPTCLPECGQPSRSLPSLVKRIIGGRNAEPGLFPWQALIVVEDTSR VPNDKWFGSGALLSASWILTAAHVLRSQRRDTTVIPVSKEHVTVYLGLHDVRDKSGAVNSSAARV VLHPDFNIQNYNHDIALVQLQEPVPLGPHVMPVCLPRLEPEGPAPHMLGLVAGWGISNPNVTVDE IISSGTRTLSDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFV IFDDLSQRWVVQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVWEQMGLPQSVVEPQVERVDHHHH HH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.