"MRPL40" Related Products

Expand
Expand

Recombinant Human MRPL40, His-tagged

Cat.No.: MRPL40-146H
Product Overview: Recombinant Human 39S Ribosomal Protein L40 Mitochondrial/MRPL40 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser47-Arg206) of Human MRPL40 fused with a polyhistidine tag at the C-terminus.
Source: HEK293
Species: Human
Tag: His
AA Sequence: SEPLRKKKKVDPKKDQEAKERLKRKIRKLEKATQELIPIEDFITPLKFLDKARERPQVELTFEET ERRALLLKKWSLYKQQERKMERDTIRAMLEAQQEALEELQLESPKLHAEAIKRDPNLFPFEKEGP HYTPPIPNYQPPEGRYNDITKVYTQVEFKRVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: MRPL40 mitochondrial ribosomal protein L40 [ Homo sapiens ]
Official Symbol: MRPL40
Synonyms: MRPL40; mitochondrial ribosomal protein L40; NLVCF, nuclear localization signal deleted in velocardiofacial syndrome; 39S ribosomal protein L40, mitochondrial; MRP L22; L40mt; MRP-L40; up-regulated in metastasis; nuclear localization signal deleted in velocardiofacial syndrome; nuclear localization signal containing protein deleted in velocardiofacial syndrome; nuclear localization signal-containing protein deleted in velocardiofacial syndrome; URIM; NLVCF; MRP-L22; MGC9400; FLJ41774;
Gene ID: 64976
mRNA Refseq: NM_003776
Protein Refseq: NP_003767
MIM: 605089
UniProt ID: Q9NQ50
Chromosome Location: 22q11.2
Function: molecular_function;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.