"BACE2" Related Products

Expand
Expand

Recombinant Human BACE2, GST-tagged

Cat.No.: BACE2-578TH
Product Overview: Human BACE2 partial ORF (306 a.a. - 395 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer''s disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 35.64 kDa
AA Sequence: TTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLY IQPMMGAGLNYECYR
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: BACE2 beta-site APP-cleaving enzyme 2 [ Homo sapiens (human) ]
Official Symbol: BACE2
Synonyms: BACE2; ASP1; BAE2; DRAP; AEPLC; ALP56; ASP21; CDA13; CEAP1; beta-site APP-cleaving enzyme 2; beta-secretase 2; memapsin-1; theta-secretase; aspartyl protease 1; 56 kDa aspartic-like protease; Down syndrome region aspartic protease; transmembrane aspartic proteinase Asp1; membrane-associated aspartic protease 1; beta-site amyloid beta A4 precursor protein-cleaving enzyme 2; EC 3.4.23.45
Gene ID: 25825
mRNA Refseq: NM_012105
Protein Refseq: NP_036237
MIM: 605668
UniProt ID: Q9Y5Z0
Chromosome Location: 21q22.3
Pathway: Alzheimer''s disease
Function: aspartic-type endopeptidase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.