Recombinant Human BACE2, GST-tagged BACE2-578TH

Recombinant Human BACE2, GST-tagged

PRODUCTS

Home / Products / Recombinant Human BACE2, GST-tagged

Recombinant Human BACE2, GST-tagged

BACE2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : BACE2-578TH
Product Overview : Human BACE2 partial ORF (306 a.a. - 395 a.a.) recombinant protein with GST-tag at N-terminal.
Description : This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer''s disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 35.64 kDa
AA Sequence : TTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSETPWSYFPKISIYLRDENSSRSFRITILPQLY IQPMMGAGLNYECYR
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot; Antibody Production; Protein Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : BACE2 beta-site APP-cleaving enzyme 2 [ Homo sapiens (human) ]
Official Symbol : BACE2
Synonyms : BACE2; ASP1; BAE2; DRAP; AEPLC; ALP56; ASP21; CDA13; CEAP1; beta-site APP-cleaving enzyme 2; beta-secretase 2; memapsin-1; theta-secretase; aspartyl protease 1; 56 kDa aspartic-like protease; Down syndrome region aspartic protease; transmembrane aspartic proteinase Asp1; membrane-associated aspartic protease 1; beta-site amyloid beta A4 precursor protein-cleaving enzyme 2; EC 3.4.23.45
Gene ID : 25825
mRNA Refseq : NM_012105
Protein Refseq : NP_036237
MIM : 605668
UniProt ID : Q9Y5Z0
Chromosome Location : 21q22.3
Pathway : Alzheimer''s disease
Function : aspartic-type endopeptidase activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy