"AMPD3" Related Products

Expand
Expand

Recombinant Human AMPD3, GST-tagged

Cat.No.: AMPD3-118H
Product Overview: Human AMPD3 partial ORF (2 a.a. - 82 a.a.) recombinant protein with GST-tag at N-terminal.
Description: This gene encodes a member of the AMP deaminase gene family. The encoded protein is a highly regulated enzyme that catalyzes the hydrolytic deamination of adenosine monophosphate to inosine monophosphate, a branch point in the adenylate catabolic pathway. This gene encodes the erythrocyte (E) isoforms, whereas other family members encode isoforms that predominate in muscle (M) and liver (L) cells. Mutations in this gene lead to the clinically asymptomatic, autosomal recessive condition erythrocyte AMP deaminase deficiency. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 34.65 kDa
AA Sequence: ALSSEPAEMPRQFPKLNISEVDEQVRLLAEKVFAKVLREEDSKDALSLFTVPEDCPIGQKEAKERELQKELAEQK SVETAK
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: AMPD3 adenosine monophosphate deaminase 3 [ Homo sapiens(human) ]
Official Symbol: AMPD3
Synonyms: AMPD3; adenosine monophosphate deaminase 3; AMP deaminase 3; AMP aminohydrolase; myoadenylate deaminase; erythrocyte AMP deaminase; erythrocyte type AMP deaminase; erythrocyte-specific AMP deaminase; adenosine monophosphate deaminase (isoform E); EC 3.5.4.6
Gene ID: 272
mRNA Refseq: NM_000480
Protein Refseq: NP_000471
MIM: 102772
UniProt ID: Q01432
Chromosome Location: 11p15
Pathway: Metabolism; Purine metabolism; Purine salvage
Function: AMP deaminase activity; metal ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.