Recombinant Human AMPD3, GST-tagged
Cat.No. : | AMPD3-118H |
Product Overview : | Human AMPD3 partial ORF (2 a.a. - 82 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the AMP deaminase gene family. The encoded protein is a highly regulated enzyme that catalyzes the hydrolytic deamination of adenosine monophosphate to inosine monophosphate, a branch point in the adenylate catabolic pathway. This gene encodes the erythrocyte (E) isoforms, whereas other family members encode isoforms that predominate in muscle (M) and liver (L) cells. Mutations in this gene lead to the clinically asymptomatic, autosomal recessive condition erythrocyte AMP deaminase deficiency. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. |
Molecular Mass : | 34.65 kDa |
AA Sequence : | ALSSEPAEMPRQFPKLNISEVDEQVRLLAEKVFAKVLREEDSKDALSLFTVPEDCPIGQKEAKERELQKELAEQK SVETAK |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | AMPD3 adenosine monophosphate deaminase 3 [ Homo sapiens(human) ] |
Official Symbol | AMPD3 |
Synonyms | AMPD3; adenosine monophosphate deaminase 3; AMP deaminase 3; AMP aminohydrolase; myoadenylate deaminase; erythrocyte AMP deaminase; erythrocyte type AMP deaminase; erythrocyte-specific AMP deaminase; adenosine monophosphate deaminase (isoform E); EC 3.5.4.6 |
Gene ID | 272 |
mRNA Refseq | NM_000480 |
Protein Refseq | NP_000471 |
MIM | 102772 |
UniProt ID | Q01432 |
Chromosome Location | 11p15 |
Pathway | Metabolism; Purine metabolism; Purine salvage |
Function | AMP deaminase activity; metal ion binding |
◆ Recombinant Proteins | ||
AMPD3-8544H | Recombinant Human AMPD3 protein, His-tagged | +Inquiry |
Ampd3-3430R | Recombinant Rat Ampd3, His-tagged | +Inquiry |
AMPD3-145H | Recombinant Human AMPD3 Protein, His-tagged | +Inquiry |
AMPD3-315R | Recombinant Rat AMPD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
AMPD3-659R | Recombinant Rat AMPD3 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AMPD3 Products
Required fields are marked with *
My Review for All AMPD3 Products
Required fields are marked with *