"CCL5" Related Products

Expand
Expand

Recombinant Swine CCL5

Cat.No.: CCL5-22S
Description: CCL5, also know as RANTES (regulated and normal T cell expressed and secreted) is a member of the C-C Chemokine Family. There are at least 27 distinct members of the C-C subgroup reported for mammals. RANTES (CCL5) is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites. CCL5 plays a role in many disease states, including rheumatoid arthritis, HIV, and cancer.
Source: Yeast
Species: Swine
Form: Lyophilized
Molecular Mass: 7.9 kDa
AA Sequence: SPYASDTTPCCFSYLSRPLPRAHLQEYFYTSSKCSMAAVVFITRKNRQVCANPEKKWVREYINTLEMS
Storage: -20 C

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.