Recombinant Human TTN, GST-tagged
Cat.No. : | TTN-27H |
Product Overview : | Recombinant Human TTN(1 a.a. - 110 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a large abundant protein of striated muscle. The product of this gene is divided into two regions, a N-terminal I-band and a C-terminal A-band. The I-band, which is the elastic part of the molecule, contains two regions of tandem immunoglobulin domains on either side of a PEVK region that is rich in proline, glutamate, valine and lysine. The A-band, which is thought to act as a protein-ruler, contains a mixture of immunoglobulin and fibronectin repeats, and possesses kinase activity. An N-terminal Z-disc region and a C-terminal M-line region bind to the Z-line and M-line of the sarcomere, respectively, so that a single titin molecule spans half the length of a sarcomere. Titin also contains binding sites for muscle associated proteins so it serves as an adhesion template for the assembly of contractile machinery in muscle cells. It has also been identified as a structural protein for chromosomes. Alternative splicing of this gene results in multiple transcript variants. Considerable variability exists in the I-band, the M-line and the Z-disc regions of titin. Variability in the I-band region contributes to the differences in elasticity of different titin isoforms and, therefore, to the differences in elasticity of different muscle types. Mutations in this gene are associated with familial hypertrophic cardiomyopathy 9, and autoantibodies to titin are produced in patients with the autoimmune disease scleroderma. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANS GRYSLKATNGSGQATSTAELLVKAETAPPNFVQRL |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TTN titin [ Homo sapiens] |
Official Symbol | TTN |
Synonyms | TTN; titin; TMD;CMH9; CMD1G; CMPD4; EOMFC; FLJ32040; FLJ26020; FLJ26409; FLJ34413; FLJ39564;FLJ43066; HMERF; MYLK5; LGMD2J; MPRM; DKFZp451N061; connectin; OTTHUMP00000233809;OTTHUMP00000233810; rhabdomyosarcoma antigen MU-RMS-40.14; cardiomyopathy,dilated 1G (autosomal dominant); EC 2.7.11.1 |
Gene ID | 7273 |
mRNA Refseq | NM_003319 |
Protein Refseq | NP_003310 |
MIM | 188840 |
UniProt ID | Q8WZ42 |
Chromosome Location | 2q31 |
Pathway | Dilated cardiomyopathy;Hemostasis; Hypertrophic cardiomyopathy (HCM); Muscle contraction; Plateletactivation; Platelet degranulation; Response to elevated platelet cytosolicCa2+; |
Function | ATP binding; actinfilament binding; alpha-actinin binding; calcium ion binding; calmodulinbinding; identical protein binding; muscle alpha-actinin binding; nucleicacid binding; nucleotide binding; protein binding; protein self-association;protein serine/threonine kinase activity; protein tyrosine kinase activity;structural constituent of muscle; telethonin binding |
◆ Recombinant Proteins | ||
TTN-27H | Recombinant Human TTN, GST-tagged | +Inquiry |
TTN-301647H | Recombinant Human TTN protein, GST-tagged | +Inquiry |
TTN-3629H | Recombinant Human TTN protein, His&Myc-tagged | +Inquiry |
TTN-1391H | Recombinant Human TTN Protein, His-tagged | +Inquiry |
TTN-705H | Recombinant Human Titin | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TTN Products
Required fields are marked with *
My Review for All TTN Products
Required fields are marked with *