"BAX" Related Products

Expand
Expand

Recombinant Human BAX, His-tagged

Cat.No.: BAX-6976H
Product Overview: Recombinant Human Apoptosis Regulator BAX/BAX is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Gln171) of Human BAX fused with a 6His tag at both the N-terminus and C-terminus.
Description: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
Source: E. coli
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μM filtered solution of PBS, pH 7.4
AA Sequence: MGSSHHHHHHSSGLVPRGSHMDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPEL ALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRV VALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQLEHH HHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: BAX BCL2-associated X protein [ Homo sapiens (human) ]
Official Symbol: BAX
Synonyms: BAX; BCL2-associated X protein; apoptosis regulator BAX; BCL2L4; bcl2-L-4; bcl-2-like protein 4; BCL2-associated X protein omega
Gene ID: 581
mRNA Refseq: NM_004324
Protein Refseq: NP_004315
MIM: 600040
UniProt ID: Q07812
Chromosome Location: 19q13.3-q13.4
Pathway: Activation, translocation and oligomerization of BAX; Amyotrophic lateral sclerosis (ALS); Apoptosis Modulation and Signaling
Function: BH3 domain binding; channel activity; identical protein binding; protein heterodimerization activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.