"MTHFD2" Related Products

Expand
Expand
Expand

Recombinant Human MTHFD2, GST-tagged

Cat.No.: MTHFD2-395H
Product Overview: Recombinant Human MTHFD2 (16 a.a. - 344 a.a.), fused with GST-tag at N-terminal, was expressed in Wheat Germ.
Description: This gene encodes a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD. Alternative splicing results in two different transcripts, one protein-coding and the other not protein-coding. This gene has a pseudogene on chromosome 7.
Source: Wheat Germ
Species: Human
Tag: GST
Molecular Mass: 61.93 kDa
AA Sequence: SLRLRPFHLAAVRNEAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVG INSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYS MLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEQLKKHTIL ADIVISAAGIPNLITADMIKEGAAVIDVGINRVHDPVTAKPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLM KNTIIAAKKVLRLEEREVLKSKELGVATN
Applications: ELSA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: MTHFD2 methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase [ Homo sapiens ]
Official Symbol: MTHFD2
Synonyms: MTHFD2; methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase; NMDMC; methylenetetrahydrofolate dehydrogenase 2; NAD-dependent methylene tetrahydrofolate dehydrogenase cyclohydrolase methylene tetrahydrofolate dehydrogenase (NAD+ dependent), methenyltetrahydrofolate cyclohydrolase; EC 1.5.1.15
Gene ID: 10797
mRNA Refseq: NM_006636
Protein Refseq: NP_006627
MIM: 604887
UniProt ID: P13995
Chromosome Location: 2p13.1
Pathway: C1-unit interconversion; Nucleotide Metabolism; One carbon pool by folate; tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate
Function: NOT formate-tetrahydrofolate ligase activity; magnesium ion binding; methenyltetrahydrofolate cyclohydrolase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.