Recombinant Human GLUD2, GST-tagged GLUD2-90H

Recombinant Human GLUD2, GST-tagged

PRODUCTS

Home / Products / Recombinant Human GLUD2, GST-tagged

Recombinant Human GLUD2, GST-tagged

GLUD2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : GLUD2-90H
Product Overview : Recombinant Human GLUD2(1 a.a. - 264 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : The protein encoded by this gene is localized to the mitochondrion and acts as a homohexamer to recycle glutamate during neurotransmission. The encoded enzyme catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate. This gene is intronless.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 54.78 kDa
AA Sequence : MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEG SILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLK NLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSAR QIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : GLUD2 glutamate dehydrogenase 2 [ Homo sapiens ]
Official Symbol : GLUD2
Synonyms : GLUD2; glutamate dehydrogenase 2; GLUDP1, glutamate dehydrogenase pseudogene 1; glutamate dehydrogenase 2, mitochondrial
Gene ID : 2747
mRNA Refseq : NM_012084
Protein Refseq : NP_036216
MIM : 300144
UniProt ID : P49448
Chromosome Location : Xq24-q25
Pathway : Proximal tubule bicarbonate reclamation; arginine biosynthesis IV; glutamate biosynthesis II
Function : ADP binding; glutamate dehydrogenase (NAD+) activity; glutamate dehydrogenase [NAD(P)+] activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy