"GLUD2" Related Products

Recombinant Human GLUD2, GST-tagged

Cat.No.: GLUD2-90H
Product Overview: Recombinant Human GLUD2(1 a.a. - 264 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The protein encoded by this gene is localized to the mitochondrion and acts as a homohexamer to recycle glutamate during neurotransmission. The encoded enzyme catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate. This gene is intronless.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 54.78 kDa
AA Sequence: MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEG SILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLK NLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSAR QIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: GLUD2 glutamate dehydrogenase 2 [ Homo sapiens ]
Official Symbol: GLUD2
Synonyms: GLUD2; glutamate dehydrogenase 2; GLUDP1, glutamate dehydrogenase pseudogene 1; glutamate dehydrogenase 2, mitochondrial
Gene ID: 2747
mRNA Refseq: NM_012084
Protein Refseq: NP_036216
MIM: 300144
UniProt ID: P49448
Chromosome Location: Xq24-q25
Pathway: Proximal tubule bicarbonate reclamation; arginine biosynthesis IV; glutamate biosynthesis II
Function: ADP binding; glutamate dehydrogenase (NAD+) activity; glutamate dehydrogenase [NAD(P)+] activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.