"TNNI2" Related Products

Expand
Expand
Expand

Recombinant Human TNNI2, GST-tagged

Cat.No.: TNNI2-17H
Product Overview: Recombinant Human TNNI2(1 a.a. - 182 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a fast-twitch skeletal muscle protein, a member of the troponin I gene family, and a component of the troponin complex including troponin T, troponin C and troponin I subunits. The troponin complex, along with tropomyosin, is responsible for the calcium-dependent regulation of striated muscle contraction. Mouse studies show that this component is also present in vascular smooth muscle and may play a role in regulation of smooth muscle function. In addition to muscle tissues, this protein is found in corneal epithelium, cartilage where it is an inhibitor of angiogenesis to inhibit tumor growth and metastasis, and mammary gland where it functions as a co-activator of estrogen receptor-related receptor alpha. This protein also suppresses tumor growth in human ovarian carcinoma. Mutations in this gene cause myopathy and distal arthrogryposis type 2B. Alternatively spliced transcript variants have been found for this gene.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 47.7 kDa
AA Sequence: MGDEEKRNRAITARRQHLKSVMLQIAATELEKEESRREAEKQNYLAEHCPPLHIPGSMSEVQELCKQLHAKIDAA EEEKYDMEVRVQKTSKELEDMNQKLFDLRGKFKRPPLRRVRMSADAMLKALLGSKHKVCMDLRANLKQVKKEDTE KERDLRDVGDWRKNIEEKSGMEGRKKMFESES
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: TNNI2 troponin I type 2 (skeletal, fast) [ Homo sapiens (human) ]
Official Symbol: TNNI2
Synonyms: TNNI2; troponin I type 2 (skeletal, fast); troponin I, skeletal, fast; troponin I, fast skeletal muscle; AMCD2B; DA2B; FSSV; troponin I fast twitch 2; troponin I; fast twitch skeletal muscle isoform
Gene ID: 7136
mRNA Refseq: NM_003282
Protein Refseq: NP_003273
MIM: 191043
UniProt ID: P48788
Chromosome Location: 11p15.5
Pathway: Muscle contraction; Striated Muscle Contraction
Function: contributes_to actin binding; protein binding; troponin T binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.