"STAT1" Related Products

Expand
Expand

Recombinant Human STAT1, no tag

Cat.No.: STAT1-73H
Product Overview: Recombinant Human Signal Transducer and Activator of Transcription 1-Alpha/Beta/STAT1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Val712) of Human STAT1.
Description: The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described.
Source: E. coli
Species: Human
Form: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4
AA Sequence: GSHMSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLS QLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQS GNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQ KQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLD QLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQ PCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHT KVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTNEGPLIVTEELHSLSFETQLCQPGLVIDLETTS LPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVD QLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFI SKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDI IRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEV
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping: The product is shipped at ambient temperature.
Gene Name: STAT1 signal transducer and activator of transcription 1, 91kDa [ Homo sapiens (human) ]
Official Symbol: STAT1
Synonyms: STAT1; signal transducer and activator of transcription 1, 91kDa; transcription factor ISGF-3 components p91/p84; Signal transducer and activator of transcription 1-alpha/beta; ISGF-3; STAT91; DKFZp686B04100; signal transducer and activator of transcription 1; OTTHUMP00000205845; signal transducer and activator of transcription-1; OTTHUMP00000165047; Transcription factor ISGF-3 components p91/p84
Gene ID: 6772
mRNA Refseq: NM_007315
Protein Refseq: NP_009330
MIM: 600555
UniProt ID: P42224
Chromosome Location: 2q32.2
Pathway: Chemokine signaling pathway; Jak-STAT signaling pathway; Pancreatic cancer; Pathways in cancer; Toll-like receptor signaling pathway; Signaling by PDGF
Function: calcium ion binding; hematopoietin/interferon-class (D200-domain) cytokine receptor signal transducer activity; protein binding; sequence-specific DNA binding; signal transducer activity; transcription factor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.