Recombinant Human CIRBP Protein, His-tagged

Cat.No. : CIRBP-604H
Product Overview : Recombinant Human CIRBP Protein(NP_001271.1), fused to His-tag, was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Form : PBS, pH 7.4.
Molecular Mass : The protein has a calculated MW of 20 kDa.
AA Sequence : MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGDRGYGGNRFESRSGGYGGSRDYYSSRSQSGGYSDRSSGGSYRDSYDSYATHNEHHHHHH
Purity : >90%, by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.1 mg/ml
Gene Name CIRBP cold inducible RNA binding protein [ Homo sapiens (human) ]
Official Symbol CIRBP
Synonyms CIRP
Gene ID 1153
mRNA Refseq NM_001280.3
Protein Refseq NP_001271.1
MIM 602649
UniProt ID Q14011

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CIRBP Products

Required fields are marked with *

My Review for All CIRBP Products

Required fields are marked with *

0
cart-icon