Recombinant Human STAT5a, His-tagged STAT5A-01H

Recombinant Human STAT5a, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human STAT5a, His-tagged

Recombinant Human STAT5a, His-tagged

STAT5A Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : STAT5A-01H
Product Overview : A DNA sequence encoding Human STAT5A ( a.a.129-712 ) was fused with a His tag .
Source : E.coli
Species : Human
Tag : His
Form : 20 mM Tris-HCl, 200 mM NaCl, pH7.4
Molecular Mass : ~67kDa
AA Sequence : PAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETA LQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSW CEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVR LLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRAD RRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVL WPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVM EVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSI RSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASAD
Purity : >92% as determined by SDS-PAGE
Storage : Short Term Storage +4°C. Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Gene Name : STAT5A signal transducer and activator of transcription 5A [ Homo sapiens ]
Official Symbol : STAT5A
Synonyms : STAT5A; signal transducer and activator of transcription 5A; STAT5; MGF;
Gene ID : 6776
mRNA Refseq : NM_003152
Protein Refseq : NP_003143
MIM : 601511
UniProt ID : P42229
Chromosome Location : 17q11.2
Pathway : Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adipogenesis, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; CD40/CD40L signaling, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chronic myeloid leukemia, organism-specific biosystem;
Function : RNA polymerase II core promoter sequence-specific DNA binding; calcium ion binding; double-stranded DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy