"STAT5A" Related Products

Expand
Expand

Recombinant Human STAT5a, His-tagged

Cat.No.: STAT5A-01H
Product Overview: A DNA sequence encoding Human STAT5A ( a.a.129-712 ) was fused with a His tag .
Source: E.coli
Species: Human
Tag: His
Form: 20 mM Tris-HCl, 200 mM NaCl, pH7.4
Molecular Mass: ~67kDa
AA Sequence: PAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETA LQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSW CEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVR LLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRAD RRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVL WPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVM EVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSI RSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASAD
Purity: >92% as determined by SDS-PAGE
Storage: Short Term Storage +4°C. Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Gene Name: STAT5A signal transducer and activator of transcription 5A [ Homo sapiens ]
Official Symbol: STAT5A
Synonyms: STAT5A; signal transducer and activator of transcription 5A; STAT5; MGF;
Gene ID: 6776
mRNA Refseq: NM_003152
Protein Refseq: NP_003143
MIM: 601511
UniProt ID: P42229
Chromosome Location: 17q11.2
Pathway: Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adipogenesis, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; CD40/CD40L signaling, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chronic myeloid leukemia, organism-specific biosystem;
Function: RNA polymerase II core promoter sequence-specific DNA binding; calcium ion binding; double-stranded DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.