Recombinant Dog Interleukin-18 IL18-01D

Recombinant Dog Interleukin-18

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Dog Interleukin-18

Recombinant Dog Interleukin-18

il18 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : IL18-01D
Source : E. coli
Species : Dog
Form : 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 5% Trehalose, pH7.4.
Molecular Mass : ~18kDa
AA Sequence : YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLS CKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIM FTVQNKS
Purity : >95% as determined by SDS-PAGE
Storage : Short Term Storage +4°C, Long Term Storage -20°C. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Reconstitution : It is recommended to reconstitute the lyophilized Dog IL18 in sterile and pre-cooled ddH2O not less than 0.1mg/ml, which can then be further diluted to other aqueous solutions.
Gene Name : IL18 interleukin 18 (interferon-gamma-inducing factor) [ Canis lupus familiaris ]
Official Symbol : il18
Synonyms : IL18; interleukin 18 (interferon-gamma-inducing factor); interleukin-18; IL-18; IL-1 gamma; interleukin-1 gamma; IFN-gamma-inducing factor; interferon gamma inducing factor; interferon gamma-inducing factor; interferon-gamma-inducing factor; IGIF;
Gene ID : 403796
mRNA Refseq : NM_001003169
Protein Refseq : NP_001003169
Pathway : African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Influenza A, organism-specific biosystem;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy