"il18" Related Products

Expand
Expand
Expand

Recombinant Dog Interleukin-18

Cat.No.: IL18-01D
Source: E. coli
Species: Dog
Form: 20 mM Tris-HCl, 100 mM NaCl, 1 mM DTT, 5% Trehalose, pH7.4.
Molecular Mass: ~18kDa
AA Sequence: YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLS CKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIM FTVQNKS
Purity: >95% as determined by SDS-PAGE
Storage: Short Term Storage +4°C, Long Term Storage -20°C. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.
Reconstitution: It is recommended to reconstitute the lyophilized Dog IL18 in sterile and pre-cooled ddH2O not less than 0.1mg/ml, which can then be further diluted to other aqueous solutions.
Gene Name: IL18 interleukin 18 (interferon-gamma-inducing factor) [ Canis lupus familiaris ]
Official Symbol: il18
Synonyms: IL18; interleukin 18 (interferon-gamma-inducing factor); interleukin-18; IL-18; IL-1 gamma; interleukin-1 gamma; IFN-gamma-inducing factor; interferon gamma inducing factor; interferon gamma-inducing factor; interferon-gamma-inducing factor; IGIF;
Gene ID: 403796
mRNA Refseq: NM_001003169
Protein Refseq: NP_001003169
Pathway: African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem; Influenza A, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.