Active Recombinant Rat Il18 Protein (159 aa)
| Cat.No. : | Il18-368I |
| Product Overview : | Recombinant rat Interleukin-18 (rrIL-18) produced in E. coli is a single non-glycosylated polypeptide chain containing 159 amino acids. A fully biologically active molecule, rrIL-18 has a molecular mass of 18.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Protein Length : | 159 |
| Description : | Interleukin-18 (IL18, also known as interferon-gamma inducing factor or IGIF) is a cytokine that belongs to the IL-1 superfamily and is produced by macrophages and other cells. Its biological activity is pleiotropic and it has been shown to induce interferon-gamma production in KG-1 cells. The combination of this cytokine and IL12 has been shown to inhibit IL4 dependent IgE and IgG1 production, and enhance IgG2a production in B cells. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 2 μg/mL resulted in the secretion of 0.15 ng/mL h-IFN-gamma when tested using KG-1 cell line, corresponding to a specific activity of > 500 units/mg. |
| Molecular Mass : | 18.4 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | MHFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% by SDS-PAGE analyses. |
| Storage : | Lyophilized recombinant ratInterleukin-18 (rrIL-18) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrIL-18 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against 50mM Tris, 50mM NaCl, pH8.0. |
| Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
| Gene Name | Il18 interleukin 18 [ Rattus norvegicus ] |
| Official Symbol | Il18 |
| Synonyms | IL18; interleukin 18; interleukin-18; IL-1 gamma; interleukin-1 gamma; IFN-gamma-inducing factor; interferon gamma-inducing factor; interferon-gamma-inducing factor; IL-18; |
| Gene ID | 29197 |
| mRNA Refseq | NM_019165 |
| Protein Refseq | NP_062038 |
| UniProt ID | P97636 |
| ◆ Recombinant Proteins | ||
| IL18-3886H | Recombinant Human IL18 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| IL18-1668HFL | Recombinant Full Length Human IL18 Protein, C-Flag-tagged | +Inquiry |
| IL18-330H | Active Recombinant Human IL18 (Tyr37-Asp193) | +Inquiry |
| IL18-3146H | Recombinant Human IL18 Protein, His (Fc)-Avi-tagged | +Inquiry |
| IL18-433H | Active Recombinant Human Interleukin 18 | +Inquiry |
| ◆ Native Proteins | ||
| IL18-01D | Recombinant Dog IL18 Protein, Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL18-344HCL | Recombinant Human IL18 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All Il18 Products
Required fields are marked with *
My Review for All Il18 Products
Required fields are marked with *


