Active Recombinant Mouse Il18 Protein, His-Tagged
| Cat.No. : | Il18-01M |
| Product Overview : | Recombinant mouse Il18 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Description : | Interleukin-18 (L-18) is a cytokine that belongs to the IL-1 superfamily and is produced by macrophages and other cells. IL-18 works by binding to the interleukin-18 receptor, and together with IL-12 it induces cell-mediated immunity following infection with microbial products like lipopolysaccharide (LPS). After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon-γ (IFN-γ) or type II interferon that plays an important role in activating the macrophages or other cells. The combination of this cytokine and IL12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production in B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity. |
| Form : | Lyophilized powder |
| AA Sequence : | MNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDD IQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS with polyhistidine tag at the C-terminus |
| Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
| Bio-activity : | Measure by its ability to induce IFN gamma secretion in KG-1 cells. The ED50 for this effect is <0.5 μg/mL. |
| Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Notes : | Please use within one month after protein reconstitution. |
| Gene Name | Il18 interleukin 18 [ Mus musculus (house mouse) ] |
| Official Symbol | Il18 |
| Synonyms | IGIF; IL-18; IL-1g; IL1F4 |
| Gene ID | 16173 |
| mRNA Refseq | NM_001357221.1 |
| Protein Refseq | NP_001344150.1 |
| UniProt ID | P70380 |
| ◆ Recombinant Proteins | ||
| Il18-5440M | Recombinant Mouse Il18 protein, His-tagged | +Inquiry |
| IL18-2296H | Active Recombinant Human IL18 protein, His-tagged | +Inquiry |
| Il18-436R | Active Recombinant Rat Il18 | +Inquiry |
| IL18-2366M | Recombinant Mouse IL18 protein(Asn36-Ser192) | +Inquiry |
| Il18-368I | Active Recombinant Rat Il18 Protein (159 aa) | +Inquiry |
| ◆ Native Proteins | ||
| IL18-01D | Recombinant Dog IL18 Protein, Tag Free | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL18-344HCL | Recombinant Human IL18 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All Il18 Products
Required fields are marked with *
My Review for All Il18 Products
Required fields are marked with *


