Active Recombinant Mouse Il18 Protein, His-Tagged
Cat.No. : | Il18-01M |
Product Overview : | Recombinant mouse Il18 Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Interleukin-18 (L-18) is a cytokine that belongs to the IL-1 superfamily and is produced by macrophages and other cells. IL-18 works by binding to the interleukin-18 receptor, and together with IL-12 it induces cell-mediated immunity following infection with microbial products like lipopolysaccharide (LPS). After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon-γ (IFN-γ) or type II interferon that plays an important role in activating the macrophages or other cells. The combination of this cytokine and IL12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production in B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity. |
Form : | Lyophilized powder |
AA Sequence : | MNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDD IQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Bio-activity : | Measure by its ability to induce IFN gamma secretion in KG-1 cells. The ED50 for this effect is <0.5 μg/mL. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Notes : | Please use within one month after protein reconstitution. |
Gene Name | Il18 interleukin 18 [ Mus musculus (house mouse) ] |
Official Symbol | Il18 |
Synonyms | IGIF; IL-18; IL-1g; IL1F4 |
Gene ID | 16173 |
mRNA Refseq | NM_001357221.1 |
Protein Refseq | NP_001344150.1 |
UniProt ID | P70380 |
◆ Recombinant Proteins | ||
Il18-6740M | Recombinant Mouse Il18 Protein (Asn36-Ser192), C-His tagged | +Inquiry |
IL18-1668HFL | Recombinant Full Length Human IL18 Protein, C-Flag-tagged | +Inquiry |
IL18-536H | Recombinant Human Interleukin 18, His-tagged | +Inquiry |
IL18-874D | Recombinant Dog IL18 protein, His-tagged | +Inquiry |
IL18-370R | Active Recombinant Rhesus Macaque IL18 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL18-344HCL | Recombinant Human IL18 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (1)
Ask a questionIL18-01HG: Sequence: a.a.37-193 Endotoxin: <20 EU/mg Bio-activity: >5.0 x 10^4 IU/mg QC: Activity test, SDS-PAGE, LAL, SEC-HPLC IL18-153HG: Protein length: Tyr37-Asp193 AA Sequence: YFGKLESKLS VIRNLNDQVL FIDQGNRPLF EDMTDSDCRD NAPRTIFIISMYKDSQPRGM AVTISVKCEK ISTLSCENKI ISFKEMNPPD NIKDTKSDIIFFQRSVPGHD NKMQFESSSY EGYFLACEKE RDLFKLILKK EDELGDRSIMFTVQNEDVD Bio-activity: 1.0*10^6IU Measured by its ability to induce IFN-gamma secretion by KG‐1 human acute myelogenous leukemia cells in the presence of TNF-alpha. QC: Activity test, SDS-PAGE, LAL IL18-500H Recombinant Human IL18 will be custom produced upon order. All the sequence, purity, activity, and QC procedures will be optional and decided by our customer.
Ask a Question for All Il18 Products
Required fields are marked with *
My Review for All Il18 Products
Required fields are marked with *
Inquiry Basket