"STAT3" Related Products

Expand
Expand

Recombinant Human STAT3, His-tagged

Cat.No.: STAT3-2176H
Product Overview: Recombinant Human STAT3(Met1-Asn175), transcript variant 3, fused with C-terminal 6His tag, was expressed in E. coli.
Description: Signal Transducer and Activator of Transcription 3 (STAT3) belongs to the transcription factor STAT family. STAT3 contains one SH2 domain and is a transcription factor expressed in most cell types. STAT3 is activated by multiple cytokines and growth factors including: IFN-a, IL-10, IL-6, IL-11, IL-12, IL-2, EGF etc. STAT3 functions as signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF and other growth factors. In addition, STAT3 may also mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4.
Source: E. coli
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4
AA Sequence: MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEID QQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQAN HPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNLEHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Usage: FOR RESEARCH USE ONLY
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) [ Homo sapiens ]
Official Symbol: STAT3
Synonyms: APRF; HIES; ADMIO; signal transducer and activator of transcription 3; DNA-binding protein APRF; acute-phase response factor
Gene ID: 6774
mRNA Refseq: NM_213662
Protein Refseq: NP_998827
MIM: 102582
UniProt ID: P40763
Chromosome Location: 17q21.31
Pathway: AGE/RAGE pathway, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Cellular responses to stress, organism-specific biosystem
Function: CCR5 chemokine receptor binding; DNA binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.