Recombinant Human STAT3, His-tagged STAT3-2176H

Recombinant Human STAT3, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human STAT3, His-tagged

Recombinant Human STAT3, His-tagged

STAT3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : STAT3-2176H
Product Overview : Recombinant Human STAT3(Met1-Asn175), transcript variant 3, fused with C-terminal 6His tag, was expressed in E. coli.
Description : Signal Transducer and Activator of Transcription 3 (STAT3) belongs to the transcription factor STAT family. STAT3 contains one SH2 domain and is a transcription factor expressed in most cell types. STAT3 is activated by multiple cytokines and growth factors including: IFN-a, IL-10, IL-6, IL-11, IL-12, IL-2, EGF etc. STAT3 functions as signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF and other growth factors. In addition, STAT3 may also mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4.
Source : E. coli
Species : Human
Tag : His
Form : Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4
AA Sequence : MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEID QQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQAN HPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNLEHHHHHH
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Usage : FOR RESEARCH USE ONLY
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name : STAT3 signal transducer and activator of transcription 3 (acute-phase response factor) [ Homo sapiens ]
Official Symbol : STAT3
Synonyms : APRF; HIES; ADMIO; signal transducer and activator of transcription 3; DNA-binding protein APRF; acute-phase response factor
Gene ID : 6774
mRNA Refseq : NM_213662
Protein Refseq : NP_998827
MIM : 102582
UniProt ID : P40763
Chromosome Location : 17q21.31
Pathway : AGE/RAGE pathway, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Cellular responses to stress, organism-specific biosystem
Function : CCR5 chemokine receptor binding; DNA binding; protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy