Recombinant Human STAT3 protein, GST-tagged
Cat.No. : | STAT3-4346H |
Product Overview : | Recombinant Human STAT3 protein(2-219 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-219 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | STAT3 |
Synonyms | STAT3; signal transducer and activator of transcription 3 (acute-phase response factor); signal transducer and activator of transcription 3; APRF; DNA-binding protein APRF; acute-phase response factor; HIES; FLJ20882; MGC16063; |
Gene ID | 6774 |
mRNA Refseq | NM_003150 |
Protein Refseq | NP_003141 |
MIM | 102582 |
UniProt ID | P40763 |
◆ Recombinant Proteins | ||
STAT3-73H | Recombinant Human Signal Transducer And Activator Of Transcription 3 | +Inquiry |
STAT3-4574HFL | Recombinant Full Length Human STAT3, Flag-tagged | +Inquiry |
STAT3-07H | Recombinant Human STAT3 Protein, His-tagged | +Inquiry |
STAT3-0258H | Recombinant Human STAT3 Protein (Full Length), C-His-tagged | +Inquiry |
STAT3-001H | Recombinant Human STAT3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT3-1418HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
STAT3-1417HCL | Recombinant Human STAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STAT3 Products
Required fields are marked with *
My Review for All STAT3 Products
Required fields are marked with *
0
Inquiry Basket