Recombinant Human MMAB, GST-tagged MMAB-630H

Recombinant Human MMAB, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human MMAB, GST-tagged

Recombinant Human MMAB, GST-tagged

MMAB Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MMAB-630H
Product Overview : Recombinant Human MMAB(1 a.a. - 100 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
Description : This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (AdoCbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. Alternatively spliced transcript variants have been found.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGER RPKDDQVFEAVGTTDELSSAIGFAL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name : MMAB methylmalonic aciduria (cobalamin deficiency) cblB type [ Homo sapiens ]
Official Symbol : MMAB
Synonyms : ATR; cob; cblB; CFAP23; cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial; ATP:cob(I)alamin adenosyltransferase; ATP:corrinoid adenosyltransferase; aquocob(I)alamin vitamin B12s adenosyltransferase; cilia and flagella associated protein 23; methylmalonic aciduria type B protein
Gene ID : 326625
mRNA Refseq : NM_052845
Protein Refseq : NP_443077
MIM : 607568
UniProt ID : Q96EY8
Chromosome Location : 12q24
Pathway : Cobalamin (Cbl, vitamin B12) transport and metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem
Function : ATP binding; cob(I)yrinic acid a,c-diamide adenosyltransferase activity; cob(I)yrinic acid a,c-diamide adenosyltransferase activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy