Recombinant Human MMAB, GST-tagged

Cat.No. : MMAB-630H
Product Overview : Recombinant Human MMAB(1 a.a. - 100 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-100 a.a.
Description : This gene encodes a protein that catalyzes the final step in the conversion of vitamin B(12) into adenosylcobalamin (AdoCbl), a vitamin B12-containing coenzyme for methylmalonyl-CoA mutase. Mutations in the gene are the cause of vitamin B12-dependent methylmalonic aciduria linked to the cblB complementation group. Alternatively spliced transcript variants have been found.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : MAVCGLGSRLGLGSRLGLRGCFGAARLLYPRFQSRGPQGVEDGDRPQPSSKTPRIPKIYTKTGDKGFSSTFTGER RPKDDQVFEAVGTTDELSSAIGFAL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name MMAB methylmalonic aciduria (cobalamin deficiency) cblB type [ Homo sapiens ]
Official Symbol MMAB
Synonyms ATR; cob; cblB; CFAP23; cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial; ATP:cob(I)alamin adenosyltransferase; ATP:corrinoid adenosyltransferase; aquocob(I)alamin vitamin B12s adenosyltransferase; cilia and flagella associated protein 23; methylmalonic aciduria type B protein
Gene ID 326625
mRNA Refseq NM_052845
Protein Refseq NP_443077
MIM 607568
UniProt ID Q96EY8
Chromosome Location 12q24
Pathway Cobalamin (Cbl, vitamin B12) transport and metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem
Function ATP binding; cob(I)yrinic acid a,c-diamide adenosyltransferase activity; cob(I)yrinic acid a,c-diamide adenosyltransferase activity

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MMAB Products

Required fields are marked with *

My Review for All MMAB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon