Recombinant Human AMHR2, Fc-tagged AMHR2-536H

Recombinant Human AMHR2, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human AMHR2, Fc-tagged

Recombinant Human AMHR2, Fc-tagged

AMHR2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : AMHR2-536H
Product Overview : The recombinant human AMHR2-Fc fusion protein is expressed as a 354 amino acid protein consisting of Pro18 - Ser144 region of AMHR2 (UniProt accession #Q16671) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Recombinant AMHR2 protein binds human AMH/MIS and blocks AMH/MIS-induced signaling activity
Molecular Mass : Calculated molecular mass (kDa): 39.0; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
AA Sequence : PPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLH CDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGESTGTHTCPPCPAPELLGGPSVF LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPE NNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : AMHR2 anti-Mullerian hormone receptor, type II [ Homo sapiens ]
Official Symbol : AMHR2
Synonyms : AMHR2; anti-Mullerian hormone receptor, type II; anti-Muellerian hormone type-2 receptor; MISR2; MISRII; M?llerian inhibiting substance type II receptor; AMH type II receptor; MIS type II receptor; anti-Muellerian hormone type II receptor; Mullerian inhibiting substance type II receptor; AMHR; MRII;
Gene ID : 269
mRNA Refseq : NM_001164690
Protein Refseq : NP_001158162
MIM : 600956
UniProt ID : Q16671
Chromosome Location : 12q13
Pathway : ALK2 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function : ATP binding; hormone binding; metal ion binding; nucleotide binding; receptor activity; transforming growth factor beta receptor activity, type II;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy