"CD99" Related Products

Expand
Expand
Expand

Recombinant Human CD99, Fc-tagged, Biotinylated

Cat.No.: CD99-589H
Product Overview: The recombinant human CD99-Fc is expressed as a 329 amino acid protein consisting of Asp23 - Ala123 region of CD99 (UniProt #P14209 - isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Immobilized CD99-Fc protein supports homophillic interaction with CD99 itself (e.g., via biotinylated CD99 protein) by a functional ELISA.
Molecular Mass: Calculated molecular mass (kDa): 35.7; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
AA Sequence: DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLA DGVSGGEGKGGSDGGGSHRKEGEEADASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: CD99 CD99 molecule [ Homo sapiens ]
Official Symbol: CD99
Synonyms: CD99; CD99 molecule; antigen identified by monoclonal antibodies 12E7, F21 and O13 , CD99 antigen , MIC2; CD99 antigen; E2 antigen; surface antigen MIC2; T-cell surface glycoprotein E2; MIC2 (monoclonal 12E7); antigen identified by monoclonal 12E7, Y homolog; antigen identified by monoclonal antibodies 12E7, F21 and O13; MIC2; HBA71; MIC2X; MIC2Y; MSK5X;
Gene ID: 4267
mRNA Refseq: NM_001122898
Protein Refseq: NP_001116370
MIM: 313470
UniProt ID: P14209
Chromosome Location: Xp22.32 and Yp11.3
Pathway: Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.