Recombinant Human CD99, Fc-tagged, Biotinylated CD99-589H

Recombinant Human CD99, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CD99, Fc-tagged, Biotinylated

Recombinant Human CD99, Fc-tagged, Biotinylated

CD99 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CD99-589H
Product Overview : The recombinant human CD99-Fc is expressed as a 329 amino acid protein consisting of Asp23 - Ala123 region of CD99 (UniProt #P14209 - isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized CD99-Fc protein supports homophillic interaction with CD99 itself (e.g., via biotinylated CD99 protein) by a functional ELISA.
Molecular Mass : Calculated molecular mass (kDa): 35.7; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
AA Sequence : DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLA DGVSGGEGKGGSDGGGSHRKEGEEADASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : CD99 CD99 molecule [ Homo sapiens ]
Official Symbol : CD99
Synonyms : CD99; CD99 molecule; antigen identified by monoclonal antibodies 12E7, F21 and O13 , CD99 antigen , MIC2; CD99 antigen; E2 antigen; surface antigen MIC2; T-cell surface glycoprotein E2; MIC2 (monoclonal 12E7); antigen identified by monoclonal 12E7, Y homolog; antigen identified by monoclonal antibodies 12E7, F21 and O13; MIC2; HBA71; MIC2X; MIC2Y; MSK5X;
Gene ID : 4267
mRNA Refseq : NM_001122898
Protein Refseq : NP_001116370
MIM : 313470
UniProt ID : P14209
Chromosome Location : Xp22.32 and Yp11.3
Pathway : Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Leukocyte transendothelial migration, conserved biosystem;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy