"RBM39" Related Products

Expand

Recombinant Human RBM39 protein, GST-tagged

Cat.No.: RBM39-246H
Product Overview: Recombinant Human RBM39 (423 a.a. - 472 a.a.), fussed with GST tag at N-terminal, was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 31.24 kDa
Protein length: 423 a.a. - 472 a.a.
AA Sequence: TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQG
Applications: Enzyme-linked Immunoabsorbent; Assay Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Name: RBM39 RNA binding motif protein 39 [ Homo sapiens ]
Official Symbol: RBM39
Synonyms: RBM39; RNA binding motif protein 39; RNA binding region (RNP1, RRM) containing 2 , RNPC2; RNA-binding protein 39; CAPER; CC1.3; fSAP59; functional spliceosome associated protein 59; HCC1; splicing factor HCC1; hepatocellular carcinoma protein 1; RNA-binding region (RNP1, RRM) containing 2; functional spliceosome-associated protein 59; coactivator of activating protein-1 and estrogen receptors; RNPC2; FSAP59; CAPERalpha; FLJ44170; DKFZp781C0423;
Gene ID: 9584
mRNA Refseq: NM_184234
Protein Refseq: NP_909122
MIM: 604739
UniProt ID: Q14498
Chromosome Location: 20q11.22
Pathway: mRNA processing, organism-specific biosystem;
Function: RNA binding; nucleic acid binding; nucleotide binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.