"IL1R1" Related Products

Expand
Expand

Recombinant Human IL1R1, Fc-tagged, Biotinylated

Cat.No.: IL1R1-627H
Product Overview: The recombinant human IL1R1 ECD is expressed as a 557 amino acid protein consisting of Leu18 -Lys336 region of IL1R1 (UniProt accession #P14778) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Interacts with human IL1α and IL1β, and blocks IL1-dependent signaling activity with a typical ED50 of 0.3 - 0.8 μg/ml
Molecular Mass: Calculated molecular mass (kDa): 63.4; Estimated by SDS-PAGE under reducing condition (kDa): 75-80 (probably due to glycosylation).
AA Sequence: LEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKDDSKTPVSTEQASRIHQHKEKLWFVPAKVEDS GHYYCVVRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCK PLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVD LGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCF AKNTHGIDAAYIQLIYPVTNFQKSTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYS KLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: IL1R1 interleukin 1 receptor, type I [ Homo sapiens ]
Official Symbol: IL1R1
Synonyms: IL1R1; interleukin 1 receptor, type I; IL1R, IL1RA; interleukin-1 receptor type 1; CD121A; D2S1473; IL-1R-1; IL-1RT1; IL-1RT-1; antigen CD121a; interleukin receptor 1; interleukin-1 receptor alpha; interleukin-1 receptor type I; CD121 antigen-like family member A; interleukin 1 receptor alpha, type I; P80; IL1R; IL1RA; IL-1R-alpha;
Gene ID: 3554
mRNA Refseq: NM_000877
Protein Refseq: NP_000868
MIM: 147810
UniProt ID: P14778
Chromosome Location: 2q12
Pathway: Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem;
Function: interleukin-1 receptor activity; interleukin-1, Type I, activating receptor activity; platelet-derived growth factor receptor binding; protease binding; protein binding; receptor activity; signal transducer activity; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.