Recombinant Human IL1RAP, Fc-tagged, Biotinylated IL1RAP-628H

Recombinant Human IL1RAP, Fc-tagged, Biotinylated

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human IL1RAP, Fc-tagged, Biotinylated

Recombinant Human IL1RAP, Fc-tagged, Biotinylated

IL1RAP Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : IL1RAP-628H
Product Overview : The recombinant human IL1RAP ECD is expressed as a 585 amino acid protein consisting of Ser21 - -Thr367 region of IL1RAP (UniProt accession #Q9NPH3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Human
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds human IL1 as well as IL1R1 and IL1R2, and blocks IL1-dependent signaling activity with a typical ED50 of 0.5 - 2.5 μg/ml.
Molecular Mass : Calculated molecular mass (kDa): 66.5; Estimated by SDS-PAGE under reducing condition (kDa): 75-80 (probably due to glycosylation).
AA Sequence : SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISK EKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFP SSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVP PVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQIL SIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVELACGFGATSTTENLYFQGSTGTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : IL1RAP interleukin 1 receptor accessory protein [ Homo sapiens ]
Official Symbol : IL1RAP
Synonyms : IL1RAP; interleukin 1 receptor accessory protein; interleukin-1 receptor accessory protein; C3orf13; IL 1RAcP; IL1R3; IL-1R3; interleukin-1 receptor 3; IL-1 receptor accessory protein; interleukin-1 receptor accessory protein beta; IL-1RAcP; FLJ37788;
Gene ID : 3556
mRNA Refseq : NM_001167928
Protein Refseq : NP_001161400
MIM : 602626
UniProt ID : Q9NPH3
Chromosome Location : 3q28
Pathway : Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL-1 Signaling Pathway, organism-specific biosystem; Immune System, organism-specific biosystem;
Function : interleukin-1 receptor activity; receptor activity; signal transducer activity; transmembrane signaling receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy