Active Recombinant Human IL1RAP, Fc-tagged, Biotinylated
Cat.No. : | IL1RAP-628H |
Product Overview : | The recombinant human IL1RAP ECD is expressed as a 585 amino acid protein consisting of Ser21 - -Thr367 region of IL1RAP (UniProt accession #Q9NPH3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 21-367 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds human IL1 as well as IL1R1 and IL1R2, and blocks IL1-dependent signaling activity with a typical ED50 of 0.5 - 2.5 μg/ml. |
Molecular Mass : | Calculated molecular mass (kDa): 66.5; Estimated by SDS-PAGE under reducing condition (kDa): 75-80 (probably due to glycosylation). |
AA Sequence : | SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISK EKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFP SSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVP PVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQIL SIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVELACGFGATSTTENLYFQGSTGTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | IL1RAP interleukin 1 receptor accessory protein [ Homo sapiens ] |
Official Symbol | IL1RAP |
Synonyms | IL1RAP; interleukin 1 receptor accessory protein; interleukin-1 receptor accessory protein; C3orf13; IL 1RAcP; IL1R3; IL-1R3; interleukin-1 receptor 3; IL-1 receptor accessory protein; interleukin-1 receptor accessory protein beta; IL-1RAcP; FLJ37788; |
Gene ID | 3556 |
mRNA Refseq | NM_001167928 |
Protein Refseq | NP_001161400 |
MIM | 602626 |
UniProt ID | Q9NPH3 |
Chromosome Location | 3q28 |
Pathway | Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL-1 Signaling Pathway, organism-specific biosystem; Immune System, organism-specific biosystem; |
Function | interleukin-1 receptor activity; receptor activity; signal transducer activity; transmembrane signaling receptor activity; |
◆ Recombinant Proteins | ||
IL1RAP-175HP | Recombinant Human IL1RAP protein, Fc-His-tagged, R-PE labeled | +Inquiry |
Il1rap-443M | Recombinant Mouse IL1RAP Protein, His-tagged | +Inquiry |
IL1RAP-0263H | Active Recombinant Human IL1RAP protein, His-tagged, FITC-Labeled | +Inquiry |
IL1RAP-1638H | Recombinant Human Interleukin 1 Receptor Accessory Protein-Like 1 | +Inquiry |
IL1RAP-0266H | Active Recombinant Human IL1RAP protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL1RAP-2730HCL | Recombinant Human IL1RAP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL1RAP Products
Required fields are marked with *
My Review for All IL1RAP Products
Required fields are marked with *