"IL1RAP" Related Products

Expand

Recombinant Human IL1RAP, Fc-tagged, Biotinylated

Cat.No.: IL1RAP-628H
Product Overview: The recombinant human IL1RAP ECD is expressed as a 585 amino acid protein consisting of Ser21 - -Thr367 region of IL1RAP (UniProt accession #Q9NPH3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells
Species: Human
Tag: Fc
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity: Binds human IL1 as well as IL1R1 and IL1R2, and blocks IL1-dependent signaling activity with a typical ED50 of 0.5 - 2.5 μg/ml.
Molecular Mass: Calculated molecular mass (kDa): 66.5; Estimated by SDS-PAGE under reducing condition (kDa): 75-80 (probably due to glycosylation).
AA Sequence: SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISK EKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFP SSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVP PVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQIL SIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVELACGFGATSTTENLYFQGSTGTHTCPPCPAP ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >95% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: IL1RAP interleukin 1 receptor accessory protein [ Homo sapiens ]
Official Symbol: IL1RAP
Synonyms: IL1RAP; interleukin 1 receptor accessory protein; interleukin-1 receptor accessory protein; C3orf13; IL 1RAcP; IL1R3; IL-1R3; interleukin-1 receptor 3; IL-1 receptor accessory protein; interleukin-1 receptor accessory protein beta; IL-1RAcP; FLJ37788;
Gene ID: 3556
mRNA Refseq: NM_001167928
Protein Refseq: NP_001161400
MIM: 602626
UniProt ID: Q9NPH3
Chromosome Location: 3q28
Pathway: Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL-1 Signaling Pathway, organism-specific biosystem; Immune System, organism-specific biosystem;
Function: interleukin-1 receptor activity; receptor activity; signal transducer activity; transmembrane signaling receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.