Recombinant Human TGFBR3, His-tagged
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
| Cat.No. : | TGFBR3-699H |
| Product Overview : | The recombinant human TGFBR3/BGCAN ECD protein is expressed as a 772 amino acid protein consisting of Gly21 - Gly781 region of TGFBR3 (UniProt accession #Q03167) and a C-terminal His tag. |
| Source : | Human cells |
| Species : | Human |
| Tag : | His |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
| Bio-activity : | Immobilized TGFBR3 protein binds human TGFβ2 in a functional ELISA. Blocks TGFβ2-mediated signaling activity. |
| Molecular Mass : | Calculated molecular mass (kDa): 85.7; Estimated by SDS-PAGE under reducing condition (kDa): 95-100 |
| AA Sequence : | GPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGLPQEVHVLNLRTAGQGPGQLQREVTLHLNPISSVH IHHKSVVFLLNSPHPLVWHLKTERLATGVSRLFLVSEGSVVQFSSANFSLTAETEERNFPHGNEHLLNWARKEY GAVTSFTELKIARNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNS NPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSI RDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAEEMGDEEVHTIPPELRILLDPGALPALQNP PIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIV AVEKDSFQASGYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWP DGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVF SVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMD KKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHE AESKEKGPSMKEPNPISPPIFHGSTGHHHHHHHH |
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the lal> |
| Purity : | >75% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Gene Name : | TGFBR3 transforming growth factor, beta receptor III [ Homo sapiens ] |
| Official Symbol : | TGFBR3 |
| Synonyms : | TGFBR3; transforming growth factor, beta receptor III; transforming growth factor, beta receptor III (betaglycan, 300kDa); transforming growth factor beta receptor type 3; betaglycan; betaglycan proteoglycan; BGCAN; TGFR-3; TGF-beta receptor type 3; TGF-beta receptor type III; |
| Gene ID : | 7049 |
| mRNA Refseq : | NM_001195683 |
| Protein Refseq : | NP_001182612 |
| MIM : | 600742 |
| UniProt ID : | Q03167 |
| Chromosome Location : | 1p33-p32 |
| Pathway : | TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem; TGF-beta receptor signaling, organism-specific biosystem; |
| Function : | PDZ domain binding; SMAD binding; coreceptor activity; glycosaminoglycan binding; glycosaminoglycan binding; heparin binding; protein binding; contributes_to protein binding; receptor activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type III; transforming growth factor beta receptor binding; transforming growth factor beta-activated receptor activity; type II transforming growth factor beta receptor binding; |
◆ Recombinant Protein
| Tgfbr3-298R | Recombinant Rat Tgfbr3 Protein, His-tagged | +Inquiry |
| Tgfbr3-297M | Recombinant Mouse Tgfbr3 Protein, His/GST-tagged | +Inquiry |
| TGFBR3-340H | Recombinant Human TGFBR3, His tagged | +Inquiry |
| TGFBR3-1685H | Recombinant Human Transforming Growth Factor, Beta Receptor III | +Inquiry |
| Tgfbr3-658M | Recombinant Mouse Tgfbr3 Protein, His-tagged | +Inquiry |
|
|
◆ Lysates
| TGFBR3-001HCL | Recombinant Human TGFBR3 cell lysate | +Inquiry |
| TGFBR3-1847MCL | Recombinant Mouse TGFBR3 cell lysate | +Inquiry |
|
|
Easy access to products and services you need from our library via powerful searching tools.
Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy
