"TGFBR3" Related Products

Expand
Expand
Expand

Recombinant Human TGFBR3, His-tagged

Cat.No.: TGFBR3-699H
Product Overview: The recombinant human TGFBR3/BGCAN ECD protein is expressed as a 772 amino acid protein consisting of Gly21 - Gly781 region of TGFBR3 (UniProt accession #Q03167) and a C-terminal His tag.
Source: Human cells
Species: Human
Tag: His
Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity: Immobilized TGFBR3 protein binds human TGFβ2 in a functional ELISA. Blocks TGFβ2-mediated signaling activity.
Molecular Mass: Calculated molecular mass (kDa): 85.7; Estimated by SDS-PAGE under reducing condition (kDa): 95-100
AA Sequence: GPEPGALCELSPVSASHPVQALMESFTVLSGCASRGTTGLPQEVHVLNLRTAGQGPGQLQREVTLHLNPISSVH IHHKSVVFLLNSPHPLVWHLKTERLATGVSRLFLVSEGSVVQFSSANFSLTAETEERNFPHGNEHLLNWARKEY GAVTSFTELKIARNIYIKVGEDQVFPPKCNIGKNFLSLNYLAEYLQPKAAEGCVMSSQPQNEEVHIIELITPNS NPYSAFQVDITIDIRPSQEDLEVVKNLILILKCKKSVNWVIKSFDVKGSLKIIAPNSIGFGKESERSMTMTKSI RDDIPSTQGNLVKWALDNGYSPITSYTMAPVANRFHLRLENNAEEMGDEEVHTIPPELRILLDPGALPALQNP PIRGGEGQNGGLPFPFPDISRRVWNEEGEDGLPRPKDPVIPSIQLFPGLREPEEVQGSVDIALSVKCDNEKMIV AVEKDSFQASGYSGMDVTLLDPTCKAKMNGTHFVLESPLNGCGTRPRWSALDGVVYYNSIVIQVPALGDSSGWP DGYEDLESGDNGFPGDMDEGDASLFTRPEIVVFNCSLQQVRNPSSFQEQPHGNITFNMELYNTDLFLVPSQGVF SVPENGHVYVEVSVTKAEQELGFAIQTCFISPYSNPDRMSHYTIIENICPKDESVKFYSPKRVHFPIPQADMD KKRFSFVFKPVFNTSLLFLQCELTLCTKMEKHPQKLPKCVPPDEACTSLDASIIWAMMQNKKTFTKPLAVIHHE AESKEKGPSMKEPNPISPPIFHGSTGHHHHHHHH
Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity: >75% judged by SDS-PAGE under reducing condition
Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name: TGFBR3 transforming growth factor, beta receptor III [ Homo sapiens ]
Official Symbol: TGFBR3
Synonyms: TGFBR3; transforming growth factor, beta receptor III; transforming growth factor, beta receptor III (betaglycan, 300kDa); transforming growth factor beta receptor type 3; betaglycan; betaglycan proteoglycan; BGCAN; TGFR-3; TGF-beta receptor type 3; TGF-beta receptor type III;
Gene ID: 7049
mRNA Refseq: NM_001195683
Protein Refseq: NP_001182612
MIM: 600742
UniProt ID: Q03167
Chromosome Location: 1p33-p32
Pathway: TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta Receptor Signaling Pathway, organism-specific biosystem; TGF-beta receptor signaling, organism-specific biosystem;
Function: PDZ domain binding; SMAD binding; coreceptor activity; glycosaminoglycan binding; glycosaminoglycan binding; heparin binding; protein binding; contributes_to protein binding; receptor activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type III; transforming growth factor beta receptor binding; transforming growth factor beta-activated receptor activity; type II transforming growth factor beta receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.