Recombinant Mouse Rspo1, Fc-tagged Rspo1-724M

Recombinant Mouse Rspo1, Fc-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Rspo1, Fc-tagged

Recombinant Mouse Rspo1, Fc-tagged

Rspo1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Rspo1-724M
Product Overview : The recombinant mouse RPSO1-Fc fusion is expressed as a 483 amino acid protein consisting of Ser21 - Gln265 region of (UniProt accession #Q9Z132) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source : Human cells
Species : Mouse
Tag : Fc
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Bio-activity : Synergizes with Wnt3a to stabilize β-catenin protein levels and induces the activation of β-catenin responsive Luciferase reporter gene in HEK293 cells with a typical ED50 of 60 - 300 ng/ml.
Molecular Mass : Calculated molecular mass (kDa): 53.8; Estimated by SDS-PAGE under reducing condition (kDa): 55-60.
AA Sequence : SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCI KCKIEHCEACFSHNFCTKCQEGLYLHKGRCYPACPEGSTAANSTMECGSPAQCEMSEWSPWGPCSKKRKLCGFR KGSEERTRRVLHAPGGDHTTCSDTKETRKCTVRRTPCPEGQKRRKGGQGRRENANRHPARKNSKEPGSNSRRHK GQQQPQPGTTGPLTSVGPTWAQSTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the lal>
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name : Rspo1 R-spondin homolog (Xenopus laevis) [ Mus musculus ]
Official Symbol : Rspo1
Synonyms : RSPO1; R-spondin homolog (Xenopus laevis); R-spondin-1; cristin-3; mCristin-3; roof plate-specific spondin-1; thrombospondin type 1 domain containing gene Rspondin; cysteine-rich and single thrombospondin domain-containing protein 3; Rspondin; R-spondin;
Gene ID : 192199
mRNA Refseq : NM_138683
Protein Refseq : NP_619624
MIM :
UniProt ID :
Function : heparin binding; receptor binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy