Recombinant Human BTLA protein, His-tagged BTLA-190H

Recombinant Human BTLA protein, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human BTLA protein, His-tagged

Recombinant Human BTLA protein, His-tagged

BTLA Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : BTLA-190H
Product Overview : Recombinant Human BTLA(Lys31-Leu150) fused with His tag at C-terminal was expressed in HEK293.
Source : HEK293
Species : Human
Tag : His
Form : Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4
Protein length : Lys31-Leu150
AA Sequence : KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNI SFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name : BTLA B and T lymphocyte associated [ Homo sapiens ]
Official Symbol : BTLA
Synonyms : BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743;
Gene ID : 151888
mRNA Refseq : NM_001085357
Protein Refseq : NP_001078826
MIM : 607925
UniProt ID : Q7Z6A9
Chromosome Location : 3q13.2
Pathway : Adaptive Immune System, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem;
Function : receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy