"BTLA" Related Products

Expand
Expand
Expand

Recombinant Human BTLA protein, His-tagged

Cat.No. : BTLA-190H
Product Overview : Recombinant Human BTLA(Lys31-Leu150) fused with His tag at C-terminal was expressed in HEK293.
Source : HEK293
Species : Human
Tag : His
Form : Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4
Protein length : Lys31-Leu150
AA Sequence : KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNI SFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Shipping : The product is shipped at ambient temperature.
Gene Name : BTLA B and T lymphocyte associated [ Homo sapiens ]
Official Symbol : BTLA
Synonyms : BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743;
Gene ID : 151888
mRNA Refseq : NM_001085357
Protein Refseq : NP_001078826
MIM : 607925
UniProt ID : Q7Z6A9
Chromosome Location : 3q13.2
Pathway : Adaptive Immune System, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem;
Function : receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.